[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56161.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:90 amino acids
:PSIPRED
:DISOPRED
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56161.1 GT:GENE BAD56161.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1472737..1473009 GB:FROM 1472737 GB:TO 1473009 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56161.1 LENGTH 90 SQ:AASEQ MSILETVLIFVGIPLVIYAAIAGLSFLGKPLPGEKPVHFELGQKWTHAPVLWSATDEVTGHGHHDTAPHGSHAAIESAQELIGGRASGKF GT:EXON 1|1-90:0| TM:NTM 1 TM:REGION 6->28| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 87-90| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEcccccccccEEEcccccccccccccccccccHHHHHHHHHHHcccccccc //