[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56165.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  59/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.113.1
:171 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->70 1su2A PDBj 3e-04 45.9 %
:RPS:PDB   4->160 3dkuA PDBj 3e-09 17.6 %
:RPS:SCOP  4->158 1f3yA  d.113.1.1 * 9e-11 20.8 %
:HMM:SCOP  1->162 1f3yA_ d.113.1.1 * 2.5e-18 27.5 %
:HMM:PFM   4->151 PF00293 * NUDIX 7.6e-15 24.0 125/135  
:BLT:SWISS 38->143 LIPB_MYXXA 6e-04 35.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56165.1 GT:GENE BAD56165.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1477152..1477667) GB:FROM 1477152 GB:TO 1477667 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56165.1 LENGTH 171 SQ:AASEQ MTDRRSAGVLVFRRDEHGTVLVLLGHMGGPFWARKDAGAWSIPKGEYEPDAEESTVAARREFAEELGVPVPEGPWIPLGEVRYGSGRGRKVLTAWAVAGDLDPAEVVPGTFEMEWPPRSGRTATFPEIDRVDWFDLPTAHDKLVAGQRPYLDRLADRLRGDQDHSRPVISS GT:EXON 1|1-171:0| BL:SWS:NREP 1 BL:SWS:REP 38->143|LIPB_MYXXA|6e-04|35.6|90/100| BL:PDB:NREP 1 BL:PDB:REP 5->70|1su2A|3e-04|45.9|61/159| RP:PDB:NREP 1 RP:PDB:REP 4->160|3dkuA|3e-09|17.6|131/153| HM:PFM:NREP 1 HM:PFM:REP 4->151|PF00293|7.6e-15|24.0|125/135|NUDIX| RP:SCP:NREP 1 RP:SCP:REP 4->158|1f3yA|9e-11|20.8|144/165|d.113.1.1| HM:SCP:REP 1->162|1f3yA_|2.5e-18|27.5|149/0|d.113.1.1|1/1|Nudix| OP:NHOMO 62 OP:NHOMOORG 61 OP:PATTERN ---------------------------------------------------11--------------- 1---1----------1111-11--1111111111111-111---11-----1111---------111111-------------------------------1---1---1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1-------1111---------------------------21------11111111---------------------------------------------------------------1---------------------------------------------------------------------1------------------1--------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 164 STR:RPRED 95.9 SQ:SECSTR cccccEEEEEEEEEETTEEEEEEEEEcccccEEccccEEEEccEEEccTTTccHHHHHHHHHHHHHcccccccccEEEEEEEEEcTTccEEEEEEEEEEccccccccccccEEEEEEHHHHHHHGTTccEEEEEcHHHHHHccccccTHHHHHHHHHHHccccc####### DISOP:02AL 1-3, 164-166, 168-171| PSIPRED ccccccccEEEEEccccccEEEEEEEcccccccccccccEEccccEEccccccHHHHHHHHHHHHcccEEccccEEEEEEEEEccccccEEEEEEEEEccccccccccccEEEccccccccccccccccEEEcccHHHHHHHHHcccHHHHHHHHHHHccccccccccccc //