[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56168.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  27/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.58.4
:131 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->91 1s7iA PDBj 5e-07 30.6 %
:RPS:SCOP  2->98 1mwqA  d.58.4.7 * 9e-06 21.4 %
:HMM:SCOP  1->131 1s7iA_ d.58.4.9 * 6e-25 37.3 %
:RPS:PFM   71->99 PF03795 * YCII 4e-04 55.2 %
:HMM:PFM   1->107 PF03795 * YCII 1.7e-14 38.8 80/95  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56168.1 GT:GENE BAD56168.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1480558..1480953) GB:FROM 1480558 GB:TO 1480953 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56168.1 LENGTH 131 SQ:AASEQ MKYILIKTYGPAEFCDTPITEWAPEDVAAHIDFQRALTAELAKSGELVDAQGLAGPEQARIVSSDGRTAPVVTDGPFPETKEFLAGYLIVDVDGPERAVEIAAKASAAPGPGGRPIGERIEVRPVMSAPAQ GT:EXON 1|1-131:0| SEG 100->121|eiaakasaapgpggrpigerie| BL:PDB:NREP 1 BL:PDB:REP 1->91|1s7iA|5e-07|30.6|85/124| RP:PFM:NREP 1 RP:PFM:REP 71->99|PF03795|4e-04|55.2|29/94|YCII| HM:PFM:NREP 1 HM:PFM:REP 1->107|PF03795|1.7e-14|38.8|80/95|YCII| RP:SCP:NREP 1 RP:SCP:REP 2->98|1mwqA|9e-06|21.4|70/100|d.58.4.7| HM:SCP:REP 1->131|1s7iA_|6e-25|37.3|118/124|d.58.4.9|1/1|Dimeric alpha+beta barrel| OP:NHOMO 40 OP:NHOMOORG 27 OP:PATTERN -------------------------------------------------------------------- --1-1--------------------1------11112142-213-2--------------121-311112---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 85 STR:RPRED 64.9 SQ:SECSTR EEEEEEEEEcGGGcccccH#####HHHHHHHHHHHHHHHHHHHHTcEEEEEEcccGGGcEEEEEccccE#EEEEccccccccEEEEEEEEE######################################## DISOP:02AL 130-131| PSIPRED ccEEEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHccEEEEccccccccccEEEEEcccccEEEEEccccccHHccccEEEEEcccHHHHHHHHHHccccccccccccccEEEEEEEcccccc //