[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56169.1
DDBJ      :             putative ferredoxin reductase
Swiss-Prot:             

Homologs  Archaea  40/68 : Bacteria  449/915 : Eukaryota  136/199 : Viruses  0/175   --->[See Alignment]
c.3.1d.87.1
:406 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   8->406 1q1wB PDBj 4e-43 30.9 %
:RPS:PDB   8->402 1d7yA PDBj 2e-25 30.1 %
:RPS:SCOP  5->135 1fcdA1  c.3.1.5 * 8e-11 21.3 %
:RPS:SCOP  180->282 1d5tA1  c.3.1.3 * 3e-09 21.4 %
:RPS:SCOP  317->406 1q1rA3  d.87.1.1 * 1e-19 36.8 %
:HMM:SCOP  1->194 1gv4A1 c.3.1.5 * 4.9e-50 44.0 %
:HMM:SCOP  105->319 1mo9A1 c.3.1.5 * 2.3e-32 38.1 %
:HMM:SCOP  315->406 1q1rA3 d.87.1.1 * 1.2e-22 43.8 %
:RPS:PFM   71->281 PF07992 * Pyr_redox_2 4e-08 34.4 %
:HMM:PFM   7->282 PF07992 * Pyr_redox_2 1.8e-46 36.1 194/202  
:BLT:SWISS 8->401 THCD_RHOER 8e-47 33.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56169.1 GT:GENE BAD56169.1 GT:PRODUCT putative ferredoxin reductase GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1481060..1482280) GB:FROM 1481060 GB:TO 1482280 GB:DIRECTION - GB:PRODUCT putative ferredoxin reductase GB:PROTEIN_ID BAD56169.1 LENGTH 406 SQ:AASEQ MTSDRRFVIVGGGLAAATLAQELRAADFPDSITLIGAEEHLPYERPPLSKEFLFGKKQLADFTVEPAQWYRDHHVELLLGTTVTGLDPRARTVTLPDGSTLPYDKLALATGSTPRRLPVPGADAPGVYTLRTIDDARALAGLFARGRLAIVGAGWIGLEVAAAARAADCAVTVVETAPQPLMGPLGPEMGAVFADLHRAHGVDLRLGARLDAVTTGADGAVTGLALADGGTVAADAVLMAVGAAPNIALAADAGLAVGTGVLVDASLRTSDPDIVAVGDIAEQAHPRLGGRIRVEHWANALNQPAVAAATMLGRAAEYDRLPYFFTDQYDLGMEYTGYATADRTARVVVRGSLADREFVAFWLDAENRVLAGMNVNVWDVTDRIKELITSATPVDPDRLADPTQPM GT:EXON 1|1-406:0| BL:SWS:NREP 1 BL:SWS:REP 8->401|THCD_RHOER|8e-47|33.8|390/427| SEG 14->26|laaatlaqelraa| SEG 77->86|lllgttvtgl| SEG 136->149|aralaglfargrla| SEG 160->174|vaaaaraadcavtvv| SEG 232->244|vaadavlmavgaa| SEG 298->309|analnqpavaaa| BL:PDB:NREP 1 BL:PDB:REP 8->406|1q1wB|4e-43|30.9|395/421| RP:PDB:NREP 1 RP:PDB:REP 8->402|1d7yA|2e-25|30.1|382/401| RP:PFM:NREP 1 RP:PFM:REP 71->281|PF07992|4e-08|34.4|195/275|Pyr_redox_2| HM:PFM:NREP 1 HM:PFM:REP 7->282|PF07992|1.8e-46|36.1|194/202|Pyr_redox_2| RP:SCP:NREP 3 RP:SCP:REP 5->135|1fcdA1|8e-11|21.3|127/186|c.3.1.5| RP:SCP:REP 180->282|1d5tA1|3e-09|21.4|98/336|c.3.1.3| RP:SCP:REP 317->406|1q1rA3|1e-19|36.8|87/103|d.87.1.1| HM:SCP:REP 1->194|1gv4A1|4.9e-50|44.0|193/0|c.3.1.5|1/2|FAD/NAD(P)-binding domain| HM:SCP:REP 105->319|1mo9A1|2.3e-32|38.1|197/0|c.3.1.5|2/2|FAD/NAD(P)-binding domain| HM:SCP:REP 315->406|1q1rA3|1.2e-22|43.8|89/103|d.87.1.1|1/1|FAD/NAD-linked reductases, dimerisation (C-terminal) domain| OP:NHOMO 1251 OP:NHOMOORG 625 OP:PATTERN ---1--11111222111-11111311111211111111----1--------1-1-1--1-1-1-1--- --3161-2222---52222-26--33222221656556FH2211122-21--224-2---1-811397443-111------11-----1111--11-----1--1-1-------------------1---------111--11111-------------------------------------2-111-1--22111112-21222211312212221-2---22-------31111111111111111111-111-11-1---22--------------------------------------------------------11-212222-2---2-11---11-2111-1-11133122121122213-----24222-----433224321112211111-11111-33333455141-322344733455144212131111211---------11116-1------------------------------1342-4432244546525555664555451562A2652121113412213334111321-1---------2225411132-2--11211------22-5111211313-------------------------223131511-1-------111----1-1--2-----1-1------112-1--2221211122-222221-112212222221312-111----------1------21111122---------------------------35222---------------4343424-1-2-21212131331421122---------11--1-----21-22---1211---------11--------------1-------------------------------11-111-1- -----11-1---111221112231112111111111111111111111111236121121-1------------------------11-1212111-1-1111111-1-1244333-11--11133-2-6A2-213-11--1111-111------2122132-21117-2-11211221911112434318311----- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 405 STR:RPRED 99.8 SQ:SECSTR #cccEEEEEEcccHHHHHHHHHHHHHTccccEEEEEcccccccccGGGGTTHHHHccGGGccHHHHccGGGcTTcEEEETccEEEEETTTTEEEETTccEEEccEEEEcccEEEcccGGGTTccccEEEcccHHHHHHHHHHccTTcEEEEcccHHHHHHHHHHHHTTcEEEEEEccccTTTTTccHHHHHHHHHHHHTTTcEEEEcccEEEEETTEEEEEEEETTTTccEEEccEEEEcccEEEccHHHHHTTccccccEEccTTcccccTTEEEcGGGEEEEcTTTccEEEcccHHHHHHHHHHHHHHHHcTccccccccEEEEEETTEEEEEEEcccccEETEEEEEccccccEEEEEEEcTETTEEEEEEEEccHHHHHHHHHHHTTccccHHHHHccccTH DISOP:02AL 1-3, 403-406| PSIPRED cccccEEEEEcccHHHHHHHHHHHHcccccEEEEEEcccccccccccccHHHHcccccHHHHHcccHHHHHHcccEEEEccEEEEEcccEEEEEEccccEEEEEEEEEEcccEEEEccccccccccEEEEccHHHHHHHHHHHccccEEEEcccHHHHHHHHHHHHcccEEEEEccccccccccccHHHHHHHHHHHHHcccEEEEccEEEEEEEccccEEEEEEEccccEEEEEEEEEEEccEEcHHHHHHccEEEccEEEEccccccccccEEEEEEEEEcccccccccEEcccHHHHHHHHHHHHHHHcccccccccccEEEEEEcccEEEEEEccccccccEEEEEEccccccEEEEEEEcccEEEEEEEEccHHHHHHHHHHHHccccccHHHHccccccc //