[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56173.1
DDBJ      :             putative formamidopyrimidine-DNA glycosylase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  575/915 : Eukaryota  10/199 : Viruses  0/175   --->[See Alignment]
a.156.1b.113.1g.39.1
:265 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   37->263 1ee8A PDBj 3e-22 30.8 %
:RPS:PDB   2->265 1ee8A PDBj 5e-46 29.5 %
:RPS:SCOP  1->122 1kfvA2  b.113.1.1 * 9e-18 18.2 %
:RPS:SCOP  139->254 1fjgM  a.156.1.1 * 1e-20 18.1 %
:RPS:SCOP  228->265 1ee8A3  g.39.1.8 * 4e-11 44.7 %
:HMM:SCOP  2->123 1k3xA2 b.113.1.1 * 4.6e-26 32.0 %
:HMM:SCOP  123->216 1r2zA1 a.156.1.2 * 3.8e-28 36.2 %
:HMM:SCOP  212->267 1ee8A3 g.39.1.8 * 8.2e-11 32.1 %
:RPS:PFM   144->206 PF06831 * H2TH 8e-12 46.0 %
:HMM:PFM   122->210 PF06831 * H2TH 4e-24 36.0 89/93  
:HMM:PFM   2->99 PF01149 * Fapy_DNA_glyco 4.9e-13 26.3 95/116  
:HMM:PFM   239->265 PF06827 * zf-FPG_IleRS 5.9e-10 37.0 27/30  
:BLT:SWISS 1->263 Y2491_MYCBO 2e-81 57.0 %
:PROS 239->263|PS01242|ZF_FPG_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56173.1 GT:GENE BAD56173.1 GT:PRODUCT putative formamidopyrimidine-DNA glycosylase GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1484784..1485581 GB:FROM 1484784 GB:TO 1485581 GB:DIRECTION + GB:PRODUCT putative formamidopyrimidine-DNA glycosylase GB:PROTEIN_ID BAD56173.1 LENGTH 265 SQ:AASEQ MPEGHTLHRLAERHQRVFAGGPVRVSSPQGRFAEGAALVDGRVLARCEAHGKHLLHHYEHGPVVHVHLGLYGKFYDAPVPMGPPVGEVRMRMVGATEGTDLRGPAACEVLTPPEVDALLERLGPDPLRADADPDRAWQRIRRSRRPIGALLMDQRVLAGVGNVYRAEVLFRHGISPYRPGVDLDAAEWKAIWADLVDLMPIGVETGRMHVVRPEHDHGEPSYAPDRPRTYVYRRPGAGCRVCGSPIAHAVLDGRNLFWCPTCQPR GT:EXON 1|1-265:0| BL:SWS:NREP 1 BL:SWS:REP 1->263|Y2491_MYCBO|2e-81|57.0|263/268| PROS 239->263|PS01242|ZF_FPG_1|PDOC00956| SEG 124->136|pdplradadpdra| BL:PDB:NREP 1 BL:PDB:REP 37->263|1ee8A|3e-22|30.8|224/266| RP:PDB:NREP 1 RP:PDB:REP 2->265|1ee8A|5e-46|29.5|258/266| RP:PFM:NREP 1 RP:PFM:REP 144->206|PF06831|8e-12|46.0|63/92|H2TH| HM:PFM:NREP 3 HM:PFM:REP 122->210|PF06831|4e-24|36.0|89/93|H2TH| HM:PFM:REP 2->99|PF01149|4.9e-13|26.3|95/116|Fapy_DNA_glyco| HM:PFM:REP 239->265|PF06827|5.9e-10|37.0|27/30|zf-FPG_IleRS| GO:PFM:NREP 5 GO:PFM GO:0003684|"GO:damaged DNA binding"|PF06831|IPR015886| GO:PFM GO:0003906|"GO:DNA-(apurinic or apyrimidinic site) lyase activity"|PF06831|IPR015886| GO:PFM GO:0006289|"GO:nucleotide-excision repair"|PF06831|IPR015886| GO:PFM GO:0008270|"GO:zinc ion binding"|PF06831|IPR015886| GO:PFM GO:0016799|"GO:hydrolase activity, hydrolyzing N-glycosyl compounds"|PF06831|IPR015886| RP:SCP:NREP 3 RP:SCP:REP 1->122|1kfvA2|9e-18|18.2|121/131|b.113.1.1| RP:SCP:REP 139->254|1fjgM|1e-20|18.1|116/125|a.156.1.1| RP:SCP:REP 228->265|1ee8A3|4e-11|44.7|38/56|g.39.1.8| HM:SCP:REP 2->123|1k3xA2|4.6e-26|32.0|122/124|b.113.1.1|1/1|N-terminal domain of MutM-like DNA repair proteins| HM:SCP:REP 123->216|1r2zA1|3.8e-28|36.2|94/0|a.156.1.2|1/1|S13-like H2TH domain| HM:SCP:REP 212->267|1ee8A3|8.2e-11|32.1|56/56|g.39.1.8|1/1|Glucocorticoid receptor-like (DNA-binding domain)| OP:NHOMO 707 OP:NHOMOORG 585 OP:PATTERN -------------------------------------------------------------------- 1121312222211212211-13--1111111121111222-2-1221233212222121121312143331-----------2------------------------------------------------------1--1111111111111111111111111111111111211-11211---11---111111111111111111111111111111-11111111111-11111111111111111111-1-11-1---111111111--1---11111111111111111111111111111111111--111---1----------------------------1---122--1-11-1-------2-111111------11111111-------------------------1----1---111---11-111111111111111111111111--1111---------1-11-1111-11-1111--11-11111111111111111111111111111111--11-----1-----1--11111111111111111111111----1---1-111-111111111----1-1--------------------------1111111-111111111111111111111111--111-1------22112212112222222-1222222212122222221222221112222222222222222222122211-111111111111---1-----11111-1-111--11-----1111-1111111-1111111111111111111111111111112111111111111111111111112222111---------------------------------------1---------------- ------1-----------------------------------------------------------------------------------------------------2------------------------------------------------------1------------111D----11------------1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 265 STR:RPRED 100.0 SQ:SECSTR EccHHHHHHHHHHHHHHHTTcEEEEEcccTTTEEcGGGGTTEEEEEEEEETTEEEEEETTTEEEEEEcTTTcEEEcccTTcEcccTTEEEEEEEcccEEEEEcTTcccEEEccTTcTHHHHccccTTcTTccHHHHHHHHHTccccHHHHHHHccccTTccHHHHHHHHHHTTccccccGGGccHHHHHHHHHHHHHHHHHHHHTTcccccccccccTTccccccGGGcccTTcTTcccTTTccccEEEEccccEEEEcTTTTTc PSIPRED cccHHHHHHHHHHHHHcccEEEEEEcccccccccHHHHHcccEEEEEEEEccEEEEEEccccEEEEEccccEEEEEEEcccccccccEEEEEEccccccccccccEEEEEEHHHHHHHHHHHccccccccccHHHHHHHHccccccHHHHHHccccccccHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHcccEEEcccccccccccccccEEEEEEccccccccccccEEEEEEEccccEEEccccccc //