[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56174.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  623/915 : Eukaryota  8/199 : Viruses  0/175   --->[See Alignment]
d.58.29
:318 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   126->298 1w25A PDBj 2e-15 36.5 %
:RPS:PDB   82->249 3btaA PDBj 1e-47 10.2 %
:RPS:SCOP  153->304 1w25A3  d.58.29.2 * 1e-26 33.6 %
:HMM:SCOP  153->308 1w25A3 d.58.29.2 * 3.7e-47 40.0 %
:RPS:PFM   150->298 PF00990 * GGDEF 4e-18 41.2 %
:HMM:PFM   148->300 PF00990 * GGDEF 9.1e-43 43.1 153/161  
:BLT:SWISS 134->302 GMR_ECOLI 4e-20 37.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56174.1 GT:GENE BAD56174.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1485658..1486614) GB:FROM 1485658 GB:TO 1486614 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56174.1 LENGTH 318 SQ:AASEQ MATDMEPPVAAMCRAWARAVCSEPGSHTTPQQLEPVLIEIVEHLLHLARSEPFPVPAARLLGARLAEPPFERTRMLAQASRWLLGFPSGRPGSLVATRWPFVASQAIDSYAQALQERALAQQEQNLSAKVSRRVQEIAALQHRLRHEATHDALTDLANRTLLQDRVRQMAADPTSCVGLLLIDLDRFKQINDCYGHAVGDEVLVELANRLREVCPPDTVICRYGGDEFVLAVNRDGDSLAEIAHRIVAALRDPVWSSAGPVPVSASVGTAFDPPGVPCDFTDLLRRADRAMYSAKTAGGRRFVFSGTDEPGIGAAVAG GT:EXON 1|1-318:0| BL:SWS:NREP 1 BL:SWS:REP 134->302|GMR_ECOLI|4e-20|37.1|167/661| SEG 111->124|aqalqeralaqqeq| SEG 253->268|pvwssagpvpvsasvg| BL:PDB:NREP 1 BL:PDB:REP 126->298|1w25A|2e-15|36.5|170/454| RP:PDB:NREP 1 RP:PDB:REP 82->249|3btaA|1e-47|10.2|166/1277| RP:PFM:NREP 1 RP:PFM:REP 150->298|PF00990|4e-18|41.2|148/160|GGDEF| HM:PFM:NREP 1 HM:PFM:REP 148->300|PF00990|9.1e-43|43.1|153/161|GGDEF| RP:SCP:NREP 1 RP:SCP:REP 153->304|1w25A3|1e-26|33.6|152/162|d.58.29.2| HM:SCP:REP 153->308|1w25A3|3.7e-47|40.0|155/0|d.58.29.2|1/1|Nucleotide cyclase| OP:NHOMO 7427 OP:NHOMOORG 631 OP:PATTERN -------------------------------------------------------------------- E636B---111---16211-1H33-111111-97777D758E9Ug-------535-----A83-E3K6543---------B-658G24--------------------1----------------1-11111114-ABB57---74eQMEHH-23CC---2--8G9-CBI4------------N4A32661572777775672767777-13333777576D3FF222222AD-1111111111111111111------1------11------1------------------------------------------------4A85H55555558474C334354627--69959CDF966599321432--9196993-----24VQQ87FVKGPQ4699489789I-TSLPPAPM9R4-KMMNTTORSTFEKE6B9291AB8A784--------BDD3-c9N11111111--1111111-11111-11111-95F83A9742EEFFHEC7776CCQZ888837GMMDKDN-2KJFXGWJMT12k96OOOQIUXWK-------56FJel3FJDEFIL7WQJHM-EDHWDGBWN444484649552----------------OAAMC32ZUFTZTjGgPYlcdedcjUbccSeVVSSsn---BUDc------CEFB3J6CCCBCBBBDA-ACBDC79BCBBBBBCCBBCBFBBD--17388777777787886B6774358--E34444433444---Q-----BDCDF8gDf---------------6566628-1-CVMLLLVVXVRVUSRKPRS-----2---VGLJIUUTTSOXPccKKEKFKHDDG------a-8844AA-1111111517-------------------------6637567656-1- ----1---------------------------------------------------------------------------------------------------------------------------------------------------------2----3---------52----------1--7-----6---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 234 STR:RPRED 73.6 SQ:SECSTR #################################################################################ccccTTccccc##ccEEEcccEEEEETTEEEEEEEcccccGGGccccccccccccTTTTccHHHHHHHHHHHHHHHHHHHTcHHHHHHHHHHHccccccTTccTTcccccGGGEEEEEcTTccEEEEEccEEEEccccTTccEEEcccccccTTTccccccEEEEcccTccEccccTTEEccEEEEEEEEccccccccTHHHHHHHHHHHHHHHTTTcccEEEcccccccTTccTH# DISOP:02AL 1-5, 313-318| PSIPRED ccccccccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHccccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHccccEEEEEEEccccccccccccHHHHHHHHHHHHHHHHHHcccccEEEEEcccEEEEEccccHHHHHHHHHHHHHHHHHHHEEccEEEEEEEEEEEEEEcccccccHHHHHHHHHHHHHHHHHccccEEEEEccccHHHcccccc //