[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56176.1
DDBJ      :             putative peptidyl-prolyl cis-trans isomerase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  322/915 : Eukaryota  188/199 : Viruses  0/175   --->[See Alignment]
d.26.1
:220 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   119->218 2ke0A PDBj 1e-22 54.1 %
:RPS:PDB   102->212 3chxA PDBj 5e-23 11.7 %
:RPS:SCOP  116->218 1u79A  d.26.1.1 * 1e-21 40.2 %
:HMM:SCOP  102->218 1q6hA_ d.26.1.1 * 2.2e-26 39.5 %
:RPS:PFM   128->216 PF00254 * FKBP_C 3e-13 40.9 %
:HMM:PFM   124->212 PF00254 * FKBP_C 6.1e-25 46.6 88/96  
:HMM:PFM   23->91 PF07174 * FAP 0.00022 25.0 68/298  
:BLT:SWISS 100->218 FKBP_STRCH 1e-28 50.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56176.1 GT:GENE BAD56176.1 GT:PRODUCT putative peptidyl-prolyl cis-trans isomerase GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1490130..1490792 GB:FROM 1490130 GB:TO 1490792 GB:DIRECTION + GB:PRODUCT putative peptidyl-prolyl cis-trans isomerase GB:PROTEIN_ID BAD56176.1 LENGTH 220 SQ:AASEQ MSGRQYPFSGADTSDGHRGRRWSRVRRMQTLARIIGIGAVTVAACALTACGSDDDSAAATSATTAPAASTQTATQPNAAQPKHGRECTAADIGVTGGFGDNPTITIPGDCDPPTRLIVEDLVEGSGPGAAAGQELTMNYSLVTWSDKQKLDSSFDRGKPFQLTLGAGQVIPGWDQGLVGVQEGARRLLIIPPDLGYGAGGNGVAPNETLVFVTDAVRVGQ GT:EXON 1|1-220:0| BL:SWS:NREP 1 BL:SWS:REP 100->218|FKBP_STRCH|1e-28|50.8|118/124| SEG 18->27|rgrrwsrvrr| SEG 38->51|gavtvaacaltacg| SEG 56->81|saaatsattapaastqtatqpnaaqp| BL:PDB:NREP 1 BL:PDB:REP 119->218|2ke0A|1e-22|54.1|98/117| RP:PDB:NREP 1 RP:PDB:REP 102->212|3chxA|5e-23|11.7|111/362| RP:PFM:NREP 1 RP:PFM:REP 128->216|PF00254|3e-13|40.9|88/91|FKBP_C| HM:PFM:NREP 2 HM:PFM:REP 124->212|PF00254|6.1e-25|46.6|88/96|FKBP_C| HM:PFM:REP 23->91|PF07174|0.00022|25.0|68/298|FAP| GO:PFM:NREP 1 GO:PFM GO:0006457|"GO:protein folding"|PF00254|IPR001179| RP:SCP:NREP 1 RP:SCP:REP 116->218|1u79A|1e-21|40.2|102/125|d.26.1.1| HM:SCP:REP 102->218|1q6hA_|2.2e-26|39.5|114/210|d.26.1.1|1/1|FKBP-like| OP:NHOMO 1257 OP:NHOMOORG 510 OP:PATTERN -------------------------------------------------------------------- -11-21111111111------1--11-----11111211-22112322311222222211222221122322222222----------1111-211---111111-41----------------------------111-----2-1111111111111111111111111111111111111111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------111111-11111------------11111111-------------------------------------------------------------------------------1-------1111111----11121111-11112221-12221212211112-111111122--111111111122---11---------32211113-111122-------------------------------1111-12--1111111-1222-2--2-1---1--1------1-11-11---------------------------------11111-----------1-1------------111111111111-------------111---------1-11----11111-211111111111-111111-111---------1111--------2--1111111111----11--221111-----1-11-------------------------------------11- ----562-5233453333332223222-122221112222222111222233231223323332323312442334433432232133-35332543133333333-4J568C77974-25562A74B3Ia8-7581443A2778354366135235771253576354873353-975t32156877E397785865B ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 119 STR:RPRED 54.1 SQ:SECSTR #####################################################################################################ccccccccccccccccccccccEEEcccccEEEEcccccccccccTTccccccTTccTTccccccccccTTccccccEEEEccHHHHTTcGGGGccccccEEEEcccccccEEEEEETc DISOP:02AL 1-6, 8-25, 49-103| PSIPRED cccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccEEEcccccccccccEEEEEEcccccccccccEEEEEEEEEEccccEEEEcccccccEEEEEEccccccHHHHHHHHccccccEEEEEEcHHHcccccccccccccEEEEEEEEEEEcc //