[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56183.1
DDBJ      :             putative integration host factor
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.156.1
:104 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  42->103 1mu5A1 a.156.1.3 * 0.00048 24.2 %
:HMM:PFM   61->77 PF00633 * HHH 1.8e-05 47.1 17/30  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56183.1 GT:GENE BAD56183.1 GT:PRODUCT putative integration host factor GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1496898..1497212 GB:FROM 1496898 GB:TO 1497212 GB:DIRECTION + GB:PRODUCT putative integration host factor GB:PROTEIN_ID BAD56183.1 LENGTH 104 SQ:AASEQ MALPTMTAEQRTEALAKAAAVRKARSELIGKVKAGKVSVADLLAKADSDDLVKKTKVAAVIKALPGVGPVKAAKLMDQAEIPEDRRIGGLGARQRAALLEALKV GT:EXON 1|1-104:0| SEG 14->25|alakaaavrkar| SEG 38->63|svadllakadsddlvkktkvaavika| HM:PFM:NREP 1 HM:PFM:REP 61->77|PF00633|1.8e-05|47.1|17/30|HHH| HM:SCP:REP 42->103|1mu5A1|0.00048|24.2|62/78|a.156.1.3|1/1|S13-like H2TH domain| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- ----1-------------------------------1-1---------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 104-105| PSIPRED cccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHccccccEEccccHHHHHHHHHHHcc //