[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56189.1
DDBJ      :             putative transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  33/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.121.1a.4.1
:222 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   39->72 2w53A PDBj 2e-05 55.9 %
:RPS:PDB   37->213 2dtzB PDBj 2e-15 10.7 %
:RPS:SCOP  37->77 1jt0A1  a.4.1.9 * 2e-10 19.5 %
:RPS:SCOP  102->206 1pb6A2  a.121.1.1 * 9e-07 20.0 %
:HMM:SCOP  29->96 2id3A1 a.4.1.9 * 3.2e-12 38.2 %
:HMM:SCOP  101->218 1pb6A2 a.121.1.1 * 2.3e-07 24.6 %
:HMM:PFM   39->85 PF00440 * TetR_N 6.7e-14 42.6 47/47  
:BLT:SWISS 39->215 Y2274_MYCBO 1e-32 44.3 %
:PROS 51->82|PS01081|HTH_TETR_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56189.1 GT:GENE BAD56189.1 GT:PRODUCT putative transcriptional regulator GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1505805..1506473) GB:FROM 1505805 GB:TO 1506473 GB:DIRECTION - GB:PRODUCT putative transcriptional regulator GB:PROTEIN_ID BAD56189.1 LENGTH 222 SQ:AASEQ MSSSNLPVVNSVPDPDRSPTDPLPTELSPTELSPIDAAIFDAARACVAEFGVRRTTLTEVARRAGVSRPTVYRRWPDTGSLVAELLVRELREILGATTPVAGDGRARLVGSVVTGAARIRENPLFAKIFRTDTDLMLTYVFGRLGRNQRALIDLFAAGIRAGQADGSIRPGEPVQLAAMLLLIAQSAVQSAGTVAGLLPADRLDAELGRAIEGYLAPDGADS GT:EXON 1|1-222:0| BL:SWS:NREP 1 BL:SWS:REP 39->215|Y2274_MYCBO|1e-32|44.3|174/189| PROS 51->82|PS01081|HTH_TETR_1|PDOC00830| SEG 2->16|sssnlpvvnsvpdpd| SEG 81->94|lvaellvrelreil| BL:PDB:NREP 1 BL:PDB:REP 39->72|2w53A|2e-05|55.9|34/202| RP:PDB:NREP 1 RP:PDB:REP 37->213|2dtzB|2e-15|10.7|177/182| HM:PFM:NREP 1 HM:PFM:REP 39->85|PF00440|6.7e-14|42.6|47/47|TetR_N| RP:SCP:NREP 2 RP:SCP:REP 37->77|1jt0A1|2e-10|19.5|41/71|a.4.1.9| RP:SCP:REP 102->206|1pb6A2|9e-07|20.0|105/126|a.121.1.1| HM:SCP:REP 29->96|2id3A1|3.2e-12|38.2|68/0|a.4.1.9|1/1|Homeodomain-like| HM:SCP:REP 101->218|1pb6A2|2.3e-07|24.6|118/0|a.121.1.1|1/1|Tetracyclin repressor-like, C-terminal domain| OP:NHOMO 37 OP:NHOMOORG 33 OP:PATTERN -------------------------------------------------------------------- ----1---------12111-11--2111111211111111-111----------------111--12-1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 192 STR:RPRED 86.5 SQ:SECSTR ##############################cccHHHHHHHHHHHHHHHHccTTTccHHHHHHTTTccTTTccccHHHHHHHHHHHHHHHHHHHHHHHHTTcccHHHHHHHHHHHHHHccccGGGHHHHHHHHTccccTTTTTTTHHHHHHHHHHHHHHHHHHHHTTccccccHHHHHHHHHHHHHHHHHTTccccHHHHHHHHHHHHHHHHHHccccHHHHH DISOP:02AL 1-37, 219-222| PSIPRED cccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHcccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHccccccc //