[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56191.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  289/915 : Eukaryota  7/199 : Viruses  0/175   --->[See Alignment]
e.52.1
:318 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   95->318 2qv7A PDBj 5e-12 32.6 %
:RPS:PDB   12->318 2bonA PDBj 4e-29 21.9 %
:RPS:SCOP  10->318 2qv7A1  e.52.1.2 * 1e-45 22.7 %
:RPS:PFM   94->124 PF00781 * DAGK_cat 3e-04 54.8 %
:HMM:PFM   12->134 PF00781 * DAGK_cat 1.7e-23 39.1 115/129  
:BLT:SWISS 93->318 DAGK_MYCTU 5e-49 47.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56191.1 GT:GENE BAD56191.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1508143..1509099 GB:FROM 1508143 GB:TO 1509099 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56191.1 LENGTH 318 SQ:AASEQ MSARETPAVRSVLVVANRLSGQGRGHDTAAAAVARLAARGVEVTEVRADSAAESVRLVRDALADPQARPGAVVCVGGDGLVCVLLDALAHAGVPLGLVPSGTGNDLARALGVPTDDTAAAVDLLLRGRTAVMDLGQITAPGAAPMWFATVAGTGFDARVTLRANRMRWPRGPLRYTVAALAEITGGIGLPYRIELAGIAPGALDNPAADGAFDTDAVMVAVGNTRTYGGGMLICPDAEPDDGLLDVTVVGAVSRLEMLRFLPALSAGKRVDHPAVRQYRAAEVTLSSPGAPATADGEPAGTLPITARAVPRALTVLVP GT:EXON 1|1-318:0| BL:SWS:NREP 1 BL:SWS:REP 93->318|DAGK_MYCTU|5e-49|47.4|215/309| SEG 29->39|aaaavarlaar| SEG 70->89|gavvcvggdglvcvlldala| BL:PDB:NREP 1 BL:PDB:REP 95->318|2qv7A|5e-12|32.6|187/293| RP:PDB:NREP 1 RP:PDB:REP 12->318|2bonA|4e-29|21.9|274/287| RP:PFM:NREP 1 RP:PFM:REP 94->124|PF00781|3e-04|54.8|31/126|DAGK_cat| HM:PFM:NREP 1 HM:PFM:REP 12->134|PF00781|1.7e-23|39.1|115/129|DAGK_cat| GO:PFM:NREP 2 GO:PFM GO:0004143|"GO:diacylglycerol kinase activity"|PF00781|IPR001206| GO:PFM GO:0007205|"GO:activation of protein kinase C activity by G-protein coupled receptor protein signaling pathway"|PF00781|IPR001206| RP:SCP:NREP 1 RP:SCP:REP 10->318|2qv7A1|1e-45|22.7|278/299|e.52.1.2| OP:NHOMO 370 OP:NHOMOORG 296 OP:PATTERN -------------------------------------------------------------------- -1111---------11111-11--111-111111111111--113221---1333111--213111311111---222111-3-----1111-111---------1-------------------1111-1-11-122212111312211111--11-------1--1122------------122--111-12111111111111111121112111122112233332321111111111111111111112121221111111--222121111111112212--------------1111111111111---111---2-11-11111111-1-2-------1---12----11-----1--111-1--1-----1--------11---1--------------1---1---11112--------------1----------------------11-2111-------------------------------------------------------------------------------------------------------------------------1------1-112112----------------------------------------------1-----------------------------------------------------------------22--------------------------------------------------1111-------------------------------------1-11-----111--------------------1---11-1-11111----------------------------------------------------1--1-111--- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------4--1---11--1-------1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 296 STR:RPRED 93.1 SQ:SECSTR ###########EEEEEccccTTcHHHHHHHHHHHTTHHHTccEEEEEcccTTHHHHHHHHHHHHTccEEEEEEcHHHHHHHHHHHHHccccccEEEEEEcccccHHHHHTTcccccHHHHHHHHHHcEEEEEEEEEEHH##TTccEEccEEEEEEEEEcccHHHHHHHHccGGHHHTccEEEEEccccEcEEEEEEET#########TTEEEEEEEcEEEEEcccccTTTccccTTccTTcccEEEEEEccccccHHHHHHHHHTTHTTcccTTEEEEEEcEEEEEEEEEEEEETTEEEEEEEEEEEEEEEEEEEEEc DISOP:02AL 1-7| PSIPRED cEEEccccccEEEEEEEcccccHHHHHHHHHHHHHHHHcccEEEEEEEcccHHHHHHHHHHHHHccccccEEEEEEcccHHHHHHHHHcccccEEEEEEcccHHcEEEEEccccccHHHHHHHHHcccEEEEEEEEEEccccccEEEEEEEHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccEEEEEEcccccEEEccccccEEcccEEEEEEEccccccccccccccccccccEEEEEEEccccHHHHHHHHHHHHcccccccccEEEEEEEEEEEEcccEEEEEcccccccccEEEEEEEcEEEEEcc //