[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56192.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:317 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   119->180 3c8uA PDBj 2e-04 40.4 %
:RPS:PDB   114->255 2ax4A PDBj 9e-07 23.3 %
:RPS:SCOP  126->261 1e2dA  c.37.1.1 * 1e-06 28.6 %
:HMM:SCOP  122->291 1kagA_ c.37.1.2 * 3.5e-10 22.6 %
:RPS:PFM   128->253 PF02223 * Thymidylate_kin 5e-04 38.5 %
:HMM:PFM   123->256 PF06414 * Zeta_toxin 4.5e-07 27.2 125/201  
:BLT:SWISS 25->130 SYL_WOLSU 2e-04 28.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56192.1 GT:GENE BAD56192.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1509128..1510081) GB:FROM 1509128 GB:TO 1510081 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56192.1 LENGTH 317 SQ:AASEQ MAEHNRGLLTTRGNTRPCRSVRYRGATGCDPAHTAEDLAATKNSPGRGRNPLAQVQSQRKSGFSLLPNRAVAWSLEEVNPPLDALPLHSPAPMTSVAGSGVLTPAAVHDLRDHAIRALRYPPRAAVVFSGVPGAGKSTALRKLFGSTADHRRPPRGPAGSVVLDSLHARNRLTPRLRMLPYPLWRPVVHLAHYTAIRRALRTADGPVIIHDCGTFAWSRRLIARWTAAAGRDLHVVMIDVPPTVARAGQYARGRRSNGLFFTLHCRRWDELIAAMADAAPAVAASVVIVDRAAINRVQEVRFDAGAAPSVAAGEATA GT:EXON 1|1-317:0| BL:SWS:NREP 1 BL:SWS:REP 25->130|SYL_WOLSU|2e-04|28.3|106/100| SEG 273->289|aamadaapavaasvviv| SEG 304->316|agaapsvaageat| BL:PDB:NREP 1 BL:PDB:REP 119->180|3c8uA|2e-04|40.4|57/203| RP:PDB:NREP 1 RP:PDB:REP 114->255|2ax4A|9e-07|23.3|133/198| RP:PFM:NREP 1 RP:PFM:REP 128->253|PF02223|5e-04|38.5|117/188|Thymidylate_kin| HM:PFM:NREP 1 HM:PFM:REP 123->256|PF06414|4.5e-07|27.2|125/201|Zeta_toxin| GO:PFM:NREP 1 GO:PFM GO:0005524|"GO:ATP binding"|PF02223|IPR000062| RP:SCP:NREP 1 RP:SCP:REP 126->261|1e2dA|1e-06|28.6|126/209|c.37.1.1| HM:SCP:REP 122->291|1kagA_|3.5e-10|22.6|146/0|c.37.1.2|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1------1--------------------1111111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 188 STR:RPRED 59.3 SQ:SECSTR ################################################################TccTTTTHHHHHHHHHHT###cccccEEccccccccccEcccTTHHHHHHHcccccccccEEEEEccTTccHHHHHHHHHHHHHHTTcHHHHHHcEEEEcHHHHTTTTTTTccccHHHHHHHHHHHHHHHHHHHHHHHTTcEEEEEcccccHHHHHHHHHHHHHTTccEEEEEEEccHHHHHHcHHHHHHT############################################################## DISOP:02AL 1-5, 40-62, 89-95, 314-317| PSIPRED cccccccEEEEccccccHHHHcccccccccHHHHHHHHHHccccccccccHHHHHHHHHHccccccccccEEEEHHHccccccccccccccccccccccccccHHHHHHHHHHccEEEEccccEEEEEEccccccHHHHHHHHHcccccccccccccccEEEEcccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccccEEEEccccHHHHHHHHHHHHHHcccEEEEEEEEcccHHHHccHHHHcccHHHHHHHHHHHHHHHHHHHHHcccHHHHHEEEEEEHHHHHHHHHHHHccccccccccccccc //