[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56195.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  11/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:136 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56195.1 GT:GENE BAD56195.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1514540..1514950 GB:FROM 1514540 GB:TO 1514950 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56195.1 LENGTH 136 SQ:AASEQ MSEERPADVPAPPDPWKGLRGVMAGTLVLESIVVLLALPVVADVGGGITWFSGSYLVILALAMILGAGLQGRSWALAFNLGLQVLVLLGGFIHLSILVIGVVFVLVWAFILILRHEVKRRMDRGLLPSQRVRPQGR GT:EXON 1|1-136:0| TM:NTM 3 TM:REGION 22->44| TM:REGION 48->69| TM:REGION 85->107| SEG 33->47|vvllalpvvadvggg| SEG 56->71|lvilalamilgaglqg| SEG 80->90|lglqvlvllgg| OP:NHOMO 11 OP:NHOMOORG 11 OP:PATTERN -------------------------------------------------------------------- ------11---1---------1-----------1111111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-10, 129-136| PSIPRED ccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccc //