[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56200.1
DDBJ      :             putative GTP-binding protein
Swiss-Prot:OBG_NOCFA    RecName: Full=GTPase obg;AltName: Full=GTP-binding protein obg;

Homologs  Archaea  59/68 : Bacteria  910/915 : Eukaryota  195/199 : Viruses  0/175   --->[See Alignment]
a.118.1b.117.1c.37.1d.242.1d.365.1
:485 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->337 1lnzA PDBj 3e-53 51.7 %
:RPS:PDB   159->347 3a1tA PDBj 2e-19 21.0 %
:RPS:SCOP  4->157 1lnzA1  b.117.1.1 * 1e-33 33.1 %
:RPS:SCOP  141->251 1z2cB1  a.118.1.23 * 2e-20 10.4 %
:RPS:SCOP  286->361 2q22A1  d.365.1.1 * 3e-04 6.6 %
:RPS:SCOP  372->440 1udxA3  d.242.1.1 * 4e-20 34.8 %
:HMM:SCOP  3->158 1lnzA1 b.117.1.1 * 2e-49 55.1 %
:HMM:SCOP  150->347 1ni3A1 c.37.1.8 * 3.8e-50 42.6 %
:HMM:SCOP  363->440 1udxA3 d.242.1.1 * 1.4e-21 44.7 %
:RPS:PFM   4->157 PF01018 * GTP1_OBG 4e-22 40.3 %
:RPS:PFM   171->245 PF01926 * MMR_HSR1 1e-13 52.0 %
:RPS:PFM   366->436 PF09269 * DUF1967 3e-15 56.5 %
:HMM:PFM   4->157 PF01018 * GTP1_OBG 2.7e-65 59.1 154/156  
:HMM:PFM   366->436 PF09269 * DUF1967 1.5e-27 49.3 69/69  
:HMM:PFM   171->293 PF01926 * MMR_HSR1 1.1e-23 39.2 102/108  
:HMM:PFM   262->333 PF10662 * PduV-EutP 0.00091 25.0 72/143  
:BLT:SWISS 1->485 OBG_NOCFA 0.0 100.0 %
:PROS 212->225|PS00905|GTP1_OBG
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56200.1 GT:GENE BAD56200.1 GT:PRODUCT putative GTP-binding protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1520346..1521803 GB:FROM 1520346 GB:TO 1521803 GB:DIRECTION + GB:PRODUCT putative GTP-binding protein GB:PROTEIN_ID BAD56200.1 LENGTH 485 SQ:AASEQ MSKFIDRVVLHVRAGKGGHGCASVHREKFKPLGGPDGGNGGNGGDVVLEVDPNVHTLLDFHFHPHAKAGNGKPGEGGNRDGKMGSDLLLKVPDGTVVLDRDGEVLVDLVGAGNRFVAARGGRGGLGNAALASKARKAPGFALLGEDGEERDLVLELKSVADVGLVGFPSAGKSSLVSVLSAAKPKIADYPFTTLVPNLGVVASGDTTFTIADVPGLIPGASQGRGLGLDFLRHLERCAVLAHVVDCATLEPGRDPISDVDALEAELAAYKPALAADAGLGDLADRPRVVILNKTDVPDAAELAEMVTPEFTARGWPVFQISAVSRAGLRPLTFALADLVREYREAHPKAAPKRPVIRPIAVDESGFTVHPDPDEPGGFIVRGARPERWVRQTQFDNDEAVGYLADRLARLGVEEELVRLGAEPGAPVTIGDVTFDWEPQISAGVDMVRTGRGTDVRLEQSDRVSAAERKHASRVRRGLVEDDEQR GT:EXON 1|1-485:0| SW:ID OBG_NOCFA SW:DE RecName: Full=GTPase obg;AltName: Full=GTP-binding protein obg; SW:GN Name=obg; OrderedLocusNames=NFA_13550; SW:KW Complete proteome; Cytoplasm; GTP-binding; Nucleotide-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->485|OBG_NOCFA|0.0|100.0|485/485| GO:SWS:NREP 3 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0005525|"GO:GTP binding"|GTP-binding| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| PROS 212->225|PS00905|GTP1_OBG|PDOC00704| SEG 31->48|plggpdggnggnggdvvl| SEG 109->131|vgagnrfvaarggrgglgnaala| SEG 261->284|aleaelaaykpalaadaglgdlad| BL:PDB:NREP 1 BL:PDB:REP 4->337|1lnzA|3e-53|51.7|315/332| RP:PDB:NREP 1 RP:PDB:REP 159->347|3a1tA|2e-19|21.0|167/254| RP:PFM:NREP 3 RP:PFM:REP 4->157|PF01018|4e-22|40.3|154/156|GTP1_OBG| RP:PFM:REP 171->245|PF01926|1e-13|52.0|75/105|MMR_HSR1| RP:PFM:REP 366->436|PF09269|3e-15|56.5|69/69|DUF1967| HM:PFM:NREP 4 HM:PFM:REP 4->157|PF01018|2.7e-65|59.1|154/156|GTP1_OBG| HM:PFM:REP 366->436|PF09269|1.5e-27|49.3|69/69|DUF1967| HM:PFM:REP 171->293|PF01926|1.1e-23|39.2|102/108|MMR_HSR1| HM:PFM:REP 262->333|PF10662|0.00091|25.0|72/143|PduV-EutP| GO:PFM:NREP 4 GO:PFM GO:0005525|"GO:GTP binding"|PF01018|IPR006169| GO:PFM GO:0005525|"GO:GTP binding"|PF01926|IPR002917| GO:PFM GO:0005622|"GO:intracellular"|PF01926|IPR002917| GO:PFM GO:0000166|"GO:nucleotide binding"|PF09269|IPR015349| RP:SCP:NREP 4 RP:SCP:REP 4->157|1lnzA1|1e-33|33.1|154/157|b.117.1.1| RP:SCP:REP 141->251|1z2cB1|2e-20|10.4|106/346|a.118.1.23| RP:SCP:REP 286->361|2q22A1|3e-04|6.6|76/130|d.365.1.1| RP:SCP:REP 372->440|1udxA3|4e-20|34.8|69/76|d.242.1.1| HM:SCP:REP 3->158|1lnzA1|2e-49|55.1|156/157|b.117.1.1|1/1|Obg GTP-binding protein N-terminal domain| HM:SCP:REP 150->347|1ni3A1|3.8e-50|42.6|197/296|c.37.1.8|1/1|P-loop containing nucleoside triphosphate hydrolases| HM:SCP:REP 363->440|1udxA3|1.4e-21|44.7|76/76|d.242.1.1|1/1|Obg GTP-binding protein C-terminal domain| OP:NHOMO 2704 OP:NHOMOORG 1164 OP:PATTERN 11111-1211111111111111121112-1111-22211111121--111112-2211111-21--11 2111222222222222222-22222222222222222221222222222222222222222222222222222222222222221222222222222112222222221222222222222222222222222222111111111111112212222111111211222212111222121122222211222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222212222222222222222222222222222222222222222122122123212222122212222122222222222222222222222222222-22222222222222222222222222211222222222222222222122212223322222222222222222122222222222222222222222222222222222222222222222222222222222222222222222222222222222222212122222222222222222222111122112222222222222222222222222222222222222222222222222222222222-2222222222222222222222222222-22222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222122222222222222222222222222222222222222222-22222222222222222221111122222222 3322436-D5423423332343433334443343233444444321534444422323334444344443424443434444444423-33333233221-1233434845676553323245396175Ec6-7873242425613343263362554645454522744424664567q77756668A36A5475444 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 437 STR:RPRED 90.1 SQ:SECSTR ###EccHHHHHHHHHHHHHHHHHTccccccHHHHHHHHHHHHHHHHHHHHTccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHTccTTccTTHHHHHHHHHHHHHHHTccHHHHHHHHHcccHHHHHHHTccTTcHHHHHHHHHHEEEEEEEccTTccHHHHHHHHHTTcEEEEEcTTcccEEEEEEEEETTEEEEEEEcccccccccHHHHHHHHHHHHHccccEEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTccEEEEEEcHHHHHHTTccccHHHHHHHHcccEEEccTTTcTTHHHHHHHHHHHHHcccccccHHHHHHHHHTcGGHHHHHHHTTTGccccTTccccccccTTTccHHTHHHHHHTcccccccccEEEEGGGTEETccTTcEEEETTEEEEccccc############################################# DISOP:02AL 68-80, 136-153, 446-485| PSIPRED ccccEEEEEEEEEEccccccccccccccccccccccccccccccEEEEEEcccHHHHHHcccccEEEccccccccccccccccccEEEEEEcccEEEEEccccEEEEEEccccEEEEEcccccccccccccccHHccccccccccccccccEEEEccccccEEEEEcccccHHHHHHHHHccccccccccccccccEEEEEEEccEEEEEEEcccccccccHHHHHHHHHHHHHHcccEEEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHccccEEEEEccccccHHHHHHHHHHHHHHHccccccccccHHHHEEccccccccEEEEEcccccEEEEEEcHHHHHHHHcccccHHHHHHHHHHHHHccHHHHHHHHccccccEEEEEEEEEEEcccccHHHHHHHccccccccccccccccHHHHHHHHHHHHccccccccc //