[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56204.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:444 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   32->120 PF00823 * PPE 3.3e-06 28.4 88/159  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56204.1 GT:GENE BAD56204.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1524967..1526301) GB:FROM 1524967 GB:TO 1526301 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56204.1 LENGTH 444 SQ:AASEQ MSGTDPTYISSMEHFESMSHEEIHAKTREIDAGEILRASGVWLEAAATLASAMPLTRAAADRVMNSMEWEGAAAEAAYASTRSFAASVEELSAVMGEVGARLGAVAAAAETVKLAVVPPGDSGPVGAIARLLEAAKVIDAQMMQEALRQEAVLAMNMVYKPAYSGAGTGVPALPDPPGTMTVPDAGDALPQPGSTPGGDYSSPGAAPEPDGAEPPLVPEGSTPPETASPEAGSAAPAPDGTPGSPSPESGTPAPSPTEEVPAPDGATPTPEAPAPPSADPAPPVPPDPSPPATEAPTPDPAPESPGPAPEPAPSTPDAPPSTETPVPPRAEVPSPPPAPETPPAPEPAPQPAPEPAPEPEPESAPEPAPAPEPAPEPEPAPAPEPAPEPEPAPPQEVPPPAPDPRAPLPDPGGQPGVTGPIPEGEQGAAHQSGTDQPGVIPTRT GT:EXON 1|1-444:0| SEG 10->22|ssmehfesmshee| SEG 72->87|aaaeaayastrsfaas| SEG 97->117|evgarlgavaaaaetvklavv| SEG 203->215|pgaapepdgaepp| SEG 223->238|ppetaspeagsaapap| SEG 240->259|gtpgspspesgtpapsptee| SEG 261->411|papdgatptpeapappsadpappvppdpsppateaptpdpapespgpapepapstpdappstetpvppraevpspppapetppapepapqpapepapepepesapepapapepapepepapapepapepepappqevpppapdpraplpdp| HM:PFM:NREP 1 HM:PFM:REP 32->120|PF00823|3.3e-06|28.4|88/159|PPE| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 8-444| PSIPRED cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc //