[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56206.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:236 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56206.1 GT:GENE BAD56206.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1526780..1527490) GB:FROM 1526780 GB:TO 1527490 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56206.1 LENGTH 236 SQ:AASEQ MHWIFTPDEFVHVWRETDVDRPPYPLRLLESPRTEQEAEVLRGRIAERFPPGADPDLTACLRILAHPHTRVVAVGTGAHQGEELRLLGCTVFDRAVLVRQDPPASPGAAGSVRVSIGHAGKLGARIASLLPKAPPGREPARAAPTAEVYDTEAVRPAPAVARIRRLLLAPHTGEGHIRIEPRLDRPQPPAPIHYTWFDVADDGRYLVKADDTVRVVPASAEQLAAQLQKRVPAQAG GT:EXON 1|1-236:0| SEG 131->147|pkappgreparaaptae| SEG 153->170|avrpapavarirrlllap| OP:NHOMO 3 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------2--1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 232-236| PSIPRED cccEEcHHHHHHHHHHcccccccccEEEEcccccccHHHHHHHHHHHHccccccHHHHHHHHHHHccccEEEEEEcccccccEEEEEEEEEEEEEEEEEEcccccccccccEEEEEEcHHHHHHHHHHHcccccccccccccccccccccEEccccccHHHHHHHHHHccccccEEEEEEEcccccccccccEEEEEEEcccccEEEEcccEEEEEcccHHHHHHHHHHHcccccc //