Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56212.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:102 amino acids

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56212.1 GT:GENE BAD56212.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1531861..1532169 GB:FROM 1531861 GB:TO 1532169 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56212.1 LENGTH 102 SQ:AASEQ MRRGEIWSYTPTLRDGTPFPRRSTVVLVSDPAVIASPYRWVHVVPVVAEDPGHVLGVYTDHGWVDAMRLHRAYRPWLSAPVGRLTPAETESLDASLRATLSL GT:EXON 1|1-102:0| OP:NHOMO 2 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------2-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 102-103| PSIPRED ccccEEEEEEcccccccccccccEEEEEcccccccccEEEEEEEEEEcccccEEEEEEEEccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccc //