[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56221.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  715/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
c.26.1
:222 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   18->214 2qtrA PDBj 2e-37 40.3 %
:RPS:PDB   18->214 3e27D PDBj 3e-37 39.8 %
:RPS:SCOP  18->214 1k4kA  c.26.1.3 * 2e-52 30.1 %
:HMM:SCOP  15->217 1nupA_ c.26.1.3 * 6.2e-57 38.1 %
:RPS:PFM   24->187 PF01467 * CTP_transf_2 1e-10 31.9 %
:HMM:PFM   23->189 PF01467 * CTP_transf_2 3.2e-41 36.1 155/157  
:BLT:SWISS 10->214 NADD_MYCVP 3e-86 70.2 %
:PROS 81->89|PS00221|MIP

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56221.1 GT:GENE BAD56221.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1541723..1542391 GB:FROM 1541723 GB:TO 1542391 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56221.1 LENGTH 222 SQ:AASEQ MRRPLSSALMHETGSTGRKLGVMGGTFDPIHHGHLVAASEVANRFDLDEVIFVPTGQPWQKAHKKVSPAEDRYLMTVIATASNPSFTVSRADIDRGKVTYTVDTLREMKAQYPDAQLYFITGADALANILSWQDWAELFELAKFVGVSRPGYELNTDHLEEHLRDLPPDAVTMLEIPALAISSSECRRRAAENRPVWYLVPDGVVQYISKRQLYVPDAAEGS GT:EXON 1|1-222:0| BL:SWS:NREP 1 BL:SWS:REP 10->214|NADD_MYCVP|3e-86|70.2|205/214| PROS 81->89|PS00221|MIP|PDOC00193| BL:PDB:NREP 1 BL:PDB:REP 18->214|2qtrA|2e-37|40.3|186/189| RP:PDB:NREP 1 RP:PDB:REP 18->214|3e27D|3e-37|39.8|186/187| RP:PFM:NREP 1 RP:PFM:REP 24->187|PF01467|1e-10|31.9|141/145|CTP_transf_2| HM:PFM:NREP 1 HM:PFM:REP 23->189|PF01467|3.2e-41|36.1|155/157|CTP_transf_2| GO:PFM:NREP 2 GO:PFM GO:0009058|"GO:biosynthetic process"|PF01467|IPR004820| GO:PFM GO:0016779|"GO:nucleotidyltransferase activity"|PF01467|IPR004820| RP:SCP:NREP 1 RP:SCP:REP 18->214|1k4kA|2e-52|30.1|196/213|c.26.1.3| HM:SCP:REP 15->217|1nupA_|6.2e-57|38.1|202/0|c.26.1.3|1/1|Nucleotidylyl transferase| OP:NHOMO 727 OP:NHOMOORG 717 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111---11111111111---------------111111111111111111111-------11-----------1111----------------1111-1111111111111111111111111111112111111111221111111111111111111111111111111111111111111222111111111111111111111111111111111111111111111112111111111111111111111111111111111111111111111-1111111------------------11111111111-11-111-1111-111111111111--111-12111111111111111-11--11-111------1-------------------11--1-1111111111111111111111111111111111111111-----111-1111111111111111111111111111-111111111111111111111111111---1111--1--1---11---1-1111-1111111111111111111111111111--11111--11111111111111111111-11211111111111111111111111111111111111111111111111111111111111111--1111111111111111------------------------11111111111111111111---------1--------------111111111-11111111--11111111111111-----1-11111-11111-1111111-111111111111 -1------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 220 STR:RPRED 99.1 SQ:SECSTR cEEEccHHHHHHHHHHTcEEEEEEEccccccHHHHHHHHHHHHHHTccEEEEEEccccTTcTTcccccHHHHHHHHHHHHTTcTTEEEccHHHHccccccHHHHHHHHHHHcTTcEEEEEEEHHHHHHGGGcTTHHHHHHHcEEEEEccTTcccccccccccEEEEEccccEEEccccccccHHHHHHHHHTTcccTTTccHHHHHHHHHHTTTcHHHHT## DISOP:02AL 1-4, 8-15, 214-222| PSIPRED ccHHHHHHHHHcccccccEEEEccccccHHHHHHHHHHHHHHHHccccEEEEEEEcccccccccccccHHHHHHHHHHHHHccccEEEEEEEcccccEEEHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHHHHHHHHHccEEEEEcccccccHHHHHHHHHHHccccEEEEEcccHHccHHHHHHHHHcccccHHcccHHHHHHHHHcccccccccccc //