[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56222.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  663/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.218.1
:134 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   39->108 2o5aB PDBj 2e-13 42.9 %
:RPS:SCOP  25->108 2id1A1  d.218.1.12 * 2e-28 36.9 %
:RPS:PFM   25->108 PF02410 * DUF143 7e-17 48.8 %
:HMM:PFM   11->108 PF02410 * DUF143 9.9e-33 48.0 98/100  
:BLT:SWISS 25->108 YBEB_SHIFL 2e-15 38.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56222.1 GT:GENE BAD56222.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1542437..1542841 GB:FROM 1542437 GB:TO 1542841 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56222.1 LENGTH 134 SQ:AASEQ MSASAEAIEMAEVAARAADEKLASDVVVLDVSEQLVITDCFVIASAPNERQVNAIVDNVEEKLRRAGHKPVRREGTREGRWALLDYVDVVVHIQHNDERNFYALERLWKDCPVVPVEGVGEPRPEAAGEGDNRA GT:EXON 1|1-134:0| BL:SWS:NREP 1 BL:SWS:REP 25->108|YBEB_SHIFL|2e-15|38.1|84/105| SEG 3->23|asaeaiemaevaaraadekla| SEG 112->125|pvvpvegvgeprpe| BL:PDB:NREP 1 BL:PDB:REP 39->108|2o5aB|2e-13|42.9|70/104| RP:PFM:NREP 1 RP:PFM:REP 25->108|PF02410|7e-17|48.8|84/99|DUF143| HM:PFM:NREP 1 HM:PFM:REP 11->108|PF02410|9.9e-33|48.0|98/100|DUF143| RP:SCP:NREP 1 RP:SCP:REP 25->108|2id1A1|2e-28|36.9|84/120|d.218.1.12| OP:NHOMO 666 OP:NHOMOORG 663 OP:PATTERN -------------------------------------------------------------------- 11-1111111111111111-11111111111111111111111111111111111111--111111111111111111111111-11-1111----1--11111-111-1111111111111111111111111111111111111111-1111111111111111111111111111111111----11-11111111111111111111111-11111111-11111111111111111111111111111--1111111-111--11-1-111---1111111111111111111111111111111111-111111111111------------11------1-11-1111111111111111111---1211111-11-1111-111-1111111111111111-11111111111-111-111---11111-1111111111111111111-1111-11111----------------------1111111-1------1111111111111111111111111111--111--------1---1111-1--1111111111111-11111-11-1---111111111111111111---------------------------11111111-111111111111111111111--1111-------11----11--1111-11-1121111111111111111111--11111111111111111111-1---1-1-111111111111-1-1111111111-111-1111--11111---111111111111111111111111111111----------1111111111111111--------11111-11---------------------------------------------1------111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 81 STR:RPRED 60.4 SQ:SECSTR ########################EEEEEEGGG###TccEEEEEEEccHHHHHHHHHHHHHHHHHTTccccEEEcTTTTcEEEEEcccEEEEEEETTccTTTcTTTcc########################## DISOP:02AL 1-5, 117-134| PSIPRED ccccHHHHHHHHHHHHHHHHcccccEEEEEcccccEEEEEEEEEEEccHHHHHHHHHHHHHHHHHcccccccccccccccEEEEEcccEEEEcccHHHHHHHHHHHHHccccEEEccccccccccccccccccc //