[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56225.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  160/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.119.1
:280 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->204 3fysA PDBj 4e-14 27.2 %
:RPS:PDB   1->204 3eglB PDBj 5e-26 30.1 %
:RPS:SCOP  1->253 1pzxA  c.119.1.1 * 2e-31 21.7 %
:HMM:SCOP  1->277 1pzxA_ c.119.1.1 * 1.9e-61 36.9 %
:RPS:PFM   75->253 PF02645 * DegV 7e-08 24.7 %
:HMM:PFM   74->276 PF02645 * DegV 7.7e-45 35.3 201/211  
:BLT:SWISS 1->203 Y2440_MYCBO 2e-23 48.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56225.1 GT:GENE BAD56225.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1544783..1545625 GB:FROM 1544783 GB:TO 1545625 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56225.1 LENGTH 280 SQ:AASEQ MAVVVVTDSSAGLPTATVDELGIAVVPLHVLVGDRAIREGVEPVEIDYTSDTVTTSAASPGEMREIYEQALRRSGGDGVVAVHVSRQLSGTWESGRQAVRDMDAGRQVRLVDSLGAGLATGLPALAAARRAARGGTLDEVYDAAVTAATRARTFILVNRTEQLRRGGRLSTAASFFGSELVTKPLLQLVEGKLELREKARTRSKAYARLVAAAVEAAGADGAAVAVQHLGAAEAAEIVAGQLRERLPELKELVVAEFGPVLAVHLGVGALGVLVIPGGCD GT:EXON 1|1-280:0| BL:SWS:NREP 1 BL:SWS:REP 1->203|Y2440_MYCBO|2e-23|48.3|201/280| SEG 114->137|lgaglatglpalaaarraarggtl| SEG 143->153|aavtaatrart| SEG 205->226|ayarlvaaaveaagadgaavav| SEG 258->278|gpvlavhlgvgalgvlvipgg| BL:PDB:NREP 1 BL:PDB:REP 1->204|3fysA|4e-14|27.2|202/282| RP:PDB:NREP 1 RP:PDB:REP 1->204|3eglB|5e-26|30.1|176/249| RP:PFM:NREP 1 RP:PFM:REP 75->253|PF02645|7e-08|24.7|178/210|DegV| HM:PFM:NREP 1 HM:PFM:REP 74->276|PF02645|7.7e-45|35.3|201/211|DegV| RP:SCP:NREP 1 RP:SCP:REP 1->253|1pzxA|2e-31|21.7|240/278|c.119.1.1| HM:SCP:REP 1->277|1pzxA_|1.9e-61|36.9|274/287|c.119.1.1|1/1|DAK1/DegV-like| OP:NHOMO 229 OP:NHOMOORG 160 OP:PATTERN -------------------------------------------------------------------- -----111---11111111-11--11111111111111111-----------1111-1--111-21111-----------11---------------------------------------------------------1155521-------------------------------------1-1--11--21222222113212222312231221221-22-111111222--------------21122----22-11-1--1111-1---2111111-111-111--------------------------------11121111111113-3----2213-1--113--122-1-242--111--11-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------3-------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 257 STR:RPRED 91.8 SQ:SECSTR cccEEEEEGGGcccHHHHHHTTcEEEccEEEETTEEEETTTTccHHHTTcccEEEEcccHHHHHHHHHHHHHHTTTccEEEEcccTTTcTHHHHHHHHHTTccTTTTEEEEcccccTHHHHHHHHHHHTTccHHHHHHHHHHHHHHHHHTEEEEEEccccHHHHHTTcccHHHHHcGHHcccccEEEEETTEEEEEcccHHHHHHHHHHHHHHHHHTTcccEEEEEEEcccTHHHHHHHHHHHHccccEEEEEEEEc####################### DISOP:02AL 51-57| PSIPRED cEEEEEEEEcccccHHHHHHcccEEEEEEEEEccEEEEccccccHHHHcccccccccccHHHHHHHHHHHHHHccccEEEEEEEcccccHHHHHHHHHHHHcccccEEEEEcccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHccEEEEEEEcHHHHHHcccccHHHHHHHHHHccEEEEEEEccEEEEEEEcccHHHHHHHHHHHHHHHHcccccEEEEEEcccHHHHHHHHHHHHHHcccccEEEEEEcccEEEEEEcccEEEEEEEEcccc //