[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56228.1
DDBJ      :             putative membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  59/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:458 amino acids
:PSIPRED
:RPS:PFM   166->301 PF03772 * Competence 2e-08 38.2 %
:HMM:PFM   166->431 PF03772 * Competence 5.4e-50 33.1 266/271  
:HMM:PFM   82->126 PF00578 * AhpC-TSA 0.00097 22.2 45/124  
:BLT:SWISS 158->289 COMEC_BACSU 2e-11 40.2 %
:PROS 143->157|PS00104|EPSP_SYNTHASE_1
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56228.1 GT:GENE BAD56228.1 GT:PRODUCT putative membrane protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1549627..1551003 GB:FROM 1549627 GB:TO 1551003 GB:DIRECTION + GB:PRODUCT putative membrane protein GB:PROTEIN_ID BAD56228.1 LENGTH 458 SQ:AASEQ MVLVAALGLAAGFALAAAWREHRAGAHPLRQLGEKAWVEVLVTPEDDPRPVRTGAGAGRSRWVVRAELREFRRGDAVVRGGGAVVVLASGPAWAEVVPGQATAFRARVQAPRSRDLTVAVLIADGPPVPVGALPWWQRAASAVRAGLAGAAGRALSTDAAGLLPALVLGDTSRLPDPVRSHFEVAGLQHLCVVSGANFTIVLTVVLGAARRLGLSPRSAVAVAAAALVMFVVVARPDPSVLRAAAMGVVTLAAVTTGRRKQALPALCAAVIGLLLYRPELAVSAGFSLSVLATGALILLAPSWADWLRERGWWQLPAEIVAVSAAAFTVTVPLLVALTGRVSLVAVAANVLVAPVIAPVTIIGAAAAAVAWFWSPLAEVVLHLAIPPLWWLLTVAGRAAAWPGAVLSVPGGAAGGFVAAAVVVAIVAALRYREPRRIVTVVAVAALSTLFLVRLLSPG GT:EXON 1|1-458:0| BL:SWS:NREP 1 BL:SWS:REP 158->289|COMEC_BACSU|2e-11|40.2|132/776| PROS 143->157|PS00104|EPSP_SYNTHASE_1|PDOC00097| TM:NTM 11 TM:REGION 1->18| TM:REGION 74->96| TM:REGION 187->209| TM:REGION 215->237| TM:REGION 263->285| TM:REGION 287->308| TM:REGION 314->336| TM:REGION 346->368| TM:REGION 377->399| TM:REGION 407->429| TM:REGION 437->458| SEG 2->18|vlvaalglaagfalaaa| SEG 72->90|rrgdavvrgggavvvlasg| SEG 138->156|raasavraglagaagrals| SEG 219->234|avavaaaalvmfvvva| SEG 320->331|vavsaaaftvtv| SEG 341->370|vslvavaanvlvapviapvtiigaaaaava| SEG 408->428|vpggaaggfvaaavvvaivaa| SEG 438->452|vtvvavaalstlflv| RP:PFM:NREP 1 RP:PFM:REP 166->301|PF03772|2e-08|38.2|136/271|Competence| HM:PFM:NREP 2 HM:PFM:REP 166->431|PF03772|5.4e-50|33.1|266/271|Competence| HM:PFM:REP 82->126|PF00578|0.00097|22.2|45/124|AhpC-TSA| OP:NHOMO 59 OP:NHOMOORG 59 OP:PATTERN -------------------------------------------------------------------- ----111111111111-11-11--111111111111111111-----11---1-11--11111-1111111----111-------------------------------------------------------------11--1-----1----------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHcccEEEEEEEEccccEEcccccccEEEEEEEEEEEEcccccccccccEEEEEEccccccccccccEEEEEEEEEccccccccEEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHcccccccHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEcccccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcccc //