[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56238.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  90/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.58.4
:124 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->111 1s7iA PDBj 4e-20 39.6 %
:RPS:SCOP  3->111 1mwqA  d.58.4.7 * 2e-10 25.0 %
:HMM:SCOP  1->118 1s7iA_ d.58.4.9 * 3.7e-31 33.9 %
:RPS:PFM   4->110 PF03795 * YCII 2e-08 40.0 %
:HMM:PFM   1->111 PF03795 * YCII 1.4e-21 37.8 90/95  
:BLT:SWISS 1->115 Y369_RHIME 6e-10 35.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56238.1 GT:GENE BAD56238.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1566765..1567139) GB:FROM 1566765 GB:TO 1567139 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56238.1 LENGTH 124 SQ:AASEQ MRYMLLFHYPEETEESLGAEAMASGRQQFAAYAATLEQAGVLVSGQVLQPSDRSTTLRLVDGRLRIQDGPYADTKEQLGGVVIIDVPDFDAALDLARQAPPLGWGCVEIRPGAVHTEDGVWVPS GT:EXON 1|1-124:0| BL:SWS:NREP 1 BL:SWS:REP 1->115|Y369_RHIME|6e-10|35.1|114/100| BL:PDB:NREP 1 BL:PDB:REP 1->111|1s7iA|4e-20|39.6|111/124| RP:PFM:NREP 1 RP:PFM:REP 4->110|PF03795|2e-08|40.0|85/94|YCII| HM:PFM:NREP 1 HM:PFM:REP 1->111|PF03795|1.4e-21|37.8|90/95|YCII| RP:SCP:NREP 1 RP:SCP:REP 3->111|1mwqA|2e-10|25.0|88/100|d.58.4.7| HM:SCP:REP 1->118|1s7iA_|3.7e-31|33.9|118/124|d.58.4.9|1/1|Dimeric alpha+beta barrel| OP:NHOMO 137 OP:NHOMOORG 90 OP:PATTERN -------------------------------------------------------------------- -22-2---------2------------------1112113----12---------1-1--23--2-1--2---------------------------------------------------------------------------------------------------1--------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------1-112-------111----------------------------13--3---45-334----1----------1--------------------------------------------------------1211112-222211122222-2111----------2-------1-----------------------------------------------1--121---------------------------------11-----------------------1--------------------------------------------------1------------------------------------------------------------1----------------------------111111111111112---------------------------11----------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 111 STR:RPRED 89.5 SQ:SECSTR EEEEEEEEEcGGGcccccHHHHHHHHHHHHHHHHHHHHHTcEEEEEEcccGGGcEEEEEccccEEEEEccccccccEEEEEEEEEEccHHHHHHHHTTcGGGGGcEEEEEE############# DISOP:02AL 14-18| PSIPRED cEEEEEEEccccccccccccHHHHHHHHHHHHHHHHHHccEEEEcccccccHHEEEEEEEccEEEEEEccccccccEEEEEEEEEcccHHHHHHHHHHcccccccEEEEEEEEEEccccccccc //