Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56240.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:90 amino acids
:HMM:PFM   43->80 PF11217 * DUF3013 0.00044 39.5 38/160  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56240.1 GT:GENE BAD56240.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1568295..1568567) GB:FROM 1568295 GB:TO 1568567 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56240.1 LENGTH 90 SQ:AASEQ MSAAGATIPRMVTVYANQTVVRAEDLPDVIRAAEVLGIGLKIENVMVPDDDGGYAPEWIVTREDEVPVYDEWEGRFEEPDDEEFSLDSAE GT:EXON 1|1-90:0| HM:PFM:NREP 1 HM:PFM:REP 43->80|PF11217|0.00044|39.5|38/160|DUF3013| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 88-90| PSIPRED cccccccccEEEEEEcccEEEEccccHHHHHHHHHHcccEEEcEEEcccccccccccEEEEccccccccccccccccccccccccccccc //