[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56243.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  50/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.34.6
:206 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   89->146 1smlA PDBj 4e-05 40.4 %
:HMM:SCOP  94->204 1ub4A_ b.34.6.2 * 8.1e-10 23.1 %
:HMM:PFM   101->199 PF02452 * PemK 1.9e-13 23.5 98/110  
:BLT:SWISS 89->146 BLA1_STEMA 1e-04 40.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56243.1 GT:GENE BAD56243.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1570097..1570717) GB:FROM 1570097 GB:TO 1570717 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56243.1 LENGTH 206 SQ:AASEQ MTAHRSRRGSAHAPARRYSPGMARNWNALGKQLSLIAKEQGPRIAKQHGPKLVEKLVGGLAQRQRRSPGVPVRPAASVPVPTEQRARRIVYSPHLDGRADPGEIVWTWVPYEEDPRNGKDRPVLVVGRDKRTLLGLMLSSNPERAHDRNWLAIGSGSWDHQGRPSWVRLDRVLDVPEAGIRREGAVLARKTFDLVAHRLVVEYNWS GT:EXON 1|1-206:0| BL:SWS:NREP 1 BL:SWS:REP 89->146|BLA1_STEMA|1e-04|40.4|52/100| SEG 67->81|spgvpvrpaasvpvp| BL:PDB:NREP 1 BL:PDB:REP 89->146|1smlA|4e-05|40.4|52/266| HM:PFM:NREP 1 HM:PFM:REP 101->199|PF02452|1.9e-13|23.5|98/110|PemK| HM:SCP:REP 94->204|1ub4A_|8.1e-10|23.1|104/0|b.34.6.2|1/1|Cell growth inhibitor/plasmid maintenance toxic component| OP:NHOMO 50 OP:NHOMOORG 50 OP:PATTERN -------------------------------------------------------------------- ----111111111111111-11--1111111111111111-1--111-1---111111----1-1--1111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 52 STR:RPRED 25.2 SQ:SECSTR ########################################################################################EEEEEEEcccccTTcEEEEEE####EEETTE##EEEEEEccccccTTccccccTTcTT############################################################ DISOP:02AL 1-14, 61-76| PSIPRED cccccccccccccccEEEcccccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccEEEEEcccccccccccEEEEEEEcccccccccccccEEEEEccccEEEEEEEcccccccccccccccccccccccccHHHHHHHHHHcccHHHccEEEEEccHHHHHHHHHHHHHHHccc //