[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56245.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:708 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56245.1 GT:GENE BAD56245.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1572775..1574901 GB:FROM 1572775 GB:TO 1574901 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56245.1 LENGTH 708 SQ:AASEQ MTRDLPFDDDTEVTEPGGDTAYKVASGVARVARAGAYVTGGALVASHGGGMPTEPGEQRLDSWNAGWAHNSDPDPDVPSPVVTFPDPEPTFEPYTPGTPGGPAPVAQHTPGAPAPGFGITVGAPPAAERSDSSGYGEYPEYHEYWRHSGTDAGYGIDPGYGGGAPEGSAPTDGGGENPFVRPEFGPGADDPSDWWQQPGGFGLPGHGLGQVGPGFGMPGAGGFLPPGSNPLLSKVPVAEETDGATDATSGAVRLGADTNPATPTNPYTGSDVYSGFDGVGEGFGVYLETDAYAQVWAKFDVDLEMGPKGVYLTTDLRVEASAGLTGKAAAGTDVGAQIDNFSQWLDSSRPGGGRLNEQQHGAGQAGGAPGAASPLGAAAPAPVHAPAAPIAPAVAATPIAPVAVAPVAPVAPVAPAPAPAAPAAAAAAPVVATPLQTTIQPEAATRPIADVFGGGSGPSPLTVPAADVPALLDLPGRHHTPAPTTPEPGTPRPTDVVPGTTAPSVPTLTPAVPTPSLPLPTPGTTLPTDVVTTPSLPDTDIVTKTPGATVTQVPTPDDDITTPGTGTGGGTSGGGTAPTTPSAPSVSVPQPTVSAPGAPTASLPAQTPPTQSVPTLDVPTGATVPPTVDVPTLPSAAVPTPVAPVKPPVPLDPKPKPISDDGGSLYHYAAYTAPADHATLAHGLGTGLWSDSGVTDVHPTAGPDAVLF GT:EXON 1|1-708:0| SEG 24->42|vasgvarvaragayvtgga| SEG 72->104|dpdpdvpspvvtfpdpeptfepytpgtpggpap| SEG 151->167|dagygidpgygggapeg| SEG 196->227|qqpggfglpghglgqvgpgfgmpgaggflppg| SEG 361->434|gagqaggapgaasplgaaapapvhapaapiapavaatpiapvavapvapvapvapapapaapaaaaaapvvatp| SEG 480->494|tpapttpepgtprpt| SEG 500->540|ttapsvptltpavptpslplptpgttlptdvvttpslpdtd| SEG 549->596|tvtqvptpdddittpgtgtgggtsgggtapttpsapsvsvpqptvsap| SEG 618->657|vptgatvpptvdvptlpsaavptpvapvkppvpldpkpkp| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 42-58, 73-284, 293-706| PSIPRED cccccccccccccccccccccEEEcccHHHHHHcEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc //