[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56248.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:85 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   12->42 PF11755 * DUF3311 8e-06 35.5 31/66  
:BLT:SWISS 7->40 Y614_MYCLE 8e-05 53.3 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56248.1 GT:GENE BAD56248.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1578838..1579095 GB:FROM 1578838 GB:TO 1579095 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56248.1 LENGTH 85 SQ:AASEQ MDRIAGWWDGFELWVAGLPFIPQFLVVLVGMVPVSFAIAYLLDRGLRACLRLLGRDRRPAPPAALVAAAPPAETVRREPVQSGAR GT:EXON 1|1-85:0| BL:SWS:NREP 1 BL:SWS:REP 7->40|Y614_MYCLE|8e-05|53.3|30/100| TM:NTM 1 TM:REGION 16->38| SEG 41->72|lldrglraclrllgrdrrpappaalvaaappa| HM:PFM:NREP 1 HM:PFM:REP 12->42|PF11755|8e-06|35.5|31/66|DUF3311| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 77-85| PSIPRED ccccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHcccccHHHHHHcHHccccc //