[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56249.1
DDBJ      :             putative transporter
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  379/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
c.94.1
:346 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   61->331 1sbpA PDBj 3e-43 37.0 %
:RPS:PDB   49->293 1amfA PDBj 7e-23 17.8 %
:RPS:SCOP  54->331 1sbpA  c.94.1.1 * 7e-77 37.2 %
:HMM:SCOP  45->342 1sbpA_ c.94.1.1 * 2.1e-64 34.4 %
:RPS:PFM   72->283 PF01547 * SBP_bac_1 7e-08 34.8 %
:HMM:PFM   60->285 PF01547 * SBP_bac_1 1.5e-22 25.4 224/314  
:BLT:SWISS 49->330 SUBI_SYNE7 6e-59 40.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56249.1 GT:GENE BAD56249.1 GT:PRODUCT putative transporter GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1579488..1580528 GB:FROM 1579488 GB:TO 1580528 GB:DIRECTION + GB:PRODUCT putative transporter GB:PROTEIN_ID BAD56249.1 LENGTH 346 SQ:AASEQ MSRTTWLAPRRRFAAAALTTVAAVVLTACGGGASDVAGGGGADGSGGSLNLYAYAVPKPGYDKVIPAFNQTEAGEGVQIQQSYGASGDQSRKVKDGAQADVVNFSVEPDITRLVDAGLVDANWNADANKGIPFGSVVAIVVRKDNPKNIRDWDDLLRPDVEVVTPNPFSSGSAKWNLLAPYAAKSDGGKNPQAGLDYLTQLLTHVKVQPKSGREATETFLQGTGDVLLSYENEAIFAERNGDPIEHIVPAQTFKIENPVAVLKNSQNPEKAVAFRDFLYTPAGQKAWAQAGFRPVDPAVAAEFTADFPTPQKLWTIADLGGWKQVDSQLFAPETGSIAVIYDNATK GT:EXON 1|1-346:0| BL:SWS:NREP 1 BL:SWS:REP 49->330|SUBI_SYNE7|6e-59|40.4|282/350| SEG 7->48|laprrrfaaaalttvaavvltacgggasdvaggggadgsggs| BL:PDB:NREP 1 BL:PDB:REP 61->331|1sbpA|3e-43|37.0|270/309| RP:PDB:NREP 1 RP:PDB:REP 49->293|1amfA|7e-23|17.8|225/231| RP:PFM:NREP 1 RP:PFM:REP 72->283|PF01547|7e-08|34.8|210/282|SBP_bac_1| HM:PFM:NREP 1 HM:PFM:REP 60->285|PF01547|1.5e-22|25.4|224/314|SBP_bac_1| GO:PFM:NREP 2 GO:PFM GO:0005215|"GO:transporter activity"|PF01547|IPR006059| GO:PFM GO:0006810|"GO:transport"|PF01547|IPR006059| RP:SCP:NREP 1 RP:SCP:REP 54->331|1sbpA|7e-77|37.2|277/309|c.94.1.1| HM:SCP:REP 45->342|1sbpA_|2.1e-64|34.4|294/309|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 625 OP:NHOMOORG 385 OP:PATTERN --------------------------------1----------------------------------- --------------21111-11111111111111111122--------1-------------1-------------------1-------------------------------------------------11----------2--1121131133------1111312---------------------1-------21-----1--11------1-1-11--------12----------------------------------------------------------------------------------------------2------------11----1-1---111-11--------------1---1111-----221111111222222222222223-11111111-31-12211121112232-----32322-1-11111111-1111213------------------------------------11122333332222222223333223321111--11112222233222223-22213-111111113132---------------12--111--1-2111--1--------------------------111-1-------1111---1112-2--2--1------------2221-222222222222-2222222222222222222222222222322222222222222222222222-22222222222211-----------1---31111-1---------22222222222222222222222221222--------------12222---1---111111111111----112222-----------------------------------------------1- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-----11-------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 298 STR:RPRED 86.1 SQ:SECSTR ################################################EEEEEEGGGHHHHHHHHHHHHHHHHHHccEEEEEEEcHHHHHHHHHHTccccEEEcccHHHHHHHHHTTcccGGGEEEEEEcEEEEEETTcccccccccTTccHHHHHTTcEEEEcTTTcHHHHHHHHHHHHTHTTHHHHHHHTTTcTcHHHHGGGEEEEcccHHHHHHHHHTTcccEEEEEHHHHHHcTcccEEEEEEccGGGcccEEEEEEEcTTcccHHHHHHHHHHTcHHHHHHHHHTTcEcEEccEEccccHHHHHHHHGGGEEEcccTTcGGGcccHHHHHHHHHHHHHHHH DISOP:02AL 1-8, 37-44, 345-346| PSIPRED cccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccEEEEEEcccHHHHHHHHHHHHHHHcccccEEEEEEEccHHHHHHHHHHcccccEEccccHHHHHHHHHHHHcccccccccccccEEEEEEEEEEEcccccccccHHHHcccccEEEEEccccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccEEcccHHHHHHHHHHccccEEEEEcHHHHHHHHccccEEEEEccccEEEcccEEEEcccccHHHHHHHHHHHccHHHHHHHHHcccccccHHHHHHHHHHccccccEEEEHHcccHHHHHHHHHcccccEEHHHHccccc //