[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56260.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  51/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.92.1
:264 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   31->141 2dj5A PDBj 5e-09 18.3 %
:RPS:PDB   182->260 2c8jB PDBj 3e-04 15.2 %
:RPS:SCOP  31->141 1tjnA  c.92.1.3 * 2e-09 18.3 %
:RPS:SCOP  180->256 1qgoA  c.92.1.2 * 1e-05 18.2 %
:HMM:SCOP  23->258 1qgoA_ c.92.1.2 * 1.1e-43 33.5 %
:RPS:PFM   31->135 PF01903 * CbiX 2e-05 31.4 %
:HMM:PFM   31->136 PF01903 * CbiX 8.8e-27 37.1 105/105  
:HMM:PFM   158->248 PF01903 * CbiX 3.3e-15 33.0 91/105  
:BLT:SWISS 31->248 SIRB_BACME 2e-06 21.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56260.1 GT:GENE BAD56260.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1593342..1594136) GB:FROM 1593342 GB:TO 1594136 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56260.1 LENGTH 264 SQ:AASEQ MNPATDMKAALGPLGQARGVAVAPALVAVAHGSRDPRSAATMSAVVDAVAAGRPEVDVRLAFLDLSTPAVAQVVDAVAAHGHAHAVVVPLLLGSAFHARVDLPGLLDAGRAAHPRLRLDQAEVLGPDPRLIAVLAERVLAADPAGDPARRGVAVAAVGSSSPAANARTAAVARALTARTGWRTESCFATAEPGLPAAVARLRARGADRVVVAPWFLAPGLLTDRLHAAAPDAIHADVLGAHRAFAEVVWDRYDAAVTAALPLSA GT:EXON 1|1-264:0| BL:SWS:NREP 1 BL:SWS:REP 31->248|SIRB_BACME|2e-06|21.1|218/266| SEG 17->30|argvavapalvava| SEG 69->88|avaqvvdavaahghahavvv| SEG 144->179|agdparrgvavaavgssspaanartaavaraltart| RP:PDB:NREP 2 RP:PDB:REP 31->141|2dj5A|5e-09|18.3|109/126| RP:PDB:REP 182->260|2c8jB|3e-04|15.2|79/310| RP:PFM:NREP 1 RP:PFM:REP 31->135|PF01903|2e-05|31.4|105/106|CbiX| HM:PFM:NREP 2 HM:PFM:REP 31->136|PF01903|8.8e-27|37.1|105/105|CbiX| HM:PFM:REP 158->248|PF01903|3.3e-15|33.0|91/105|CbiX| GO:PFM:NREP 3 GO:PFM GO:0009236|"GO:cobalamin biosynthetic process"|PF01903|IPR002762| GO:PFM GO:0016829|"GO:lyase activity"|PF01903|IPR002762| GO:PFM GO:0046872|"GO:metal ion binding"|PF01903|IPR002762| RP:SCP:NREP 2 RP:SCP:REP 31->141|1tjnA|2e-09|18.3|109/125|c.92.1.3| RP:SCP:REP 180->256|1qgoA|1e-05|18.2|77/257|c.92.1.2| HM:SCP:REP 23->258|1qgoA_|1.1e-43|33.5|230/0|c.92.1.2|1/1|Chelatase| OP:NHOMO 53 OP:NHOMOORG 51 OP:PATTERN -------------------------------------------------------------------- ----1---------11111-11--21111112111111111---------------------1-1111-11-----------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111---------------1---1----11--111--11-1-1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 190 STR:RPRED 72.0 SQ:SECSTR ##############################cccccHHHHHHHHHHHHHHHHHTcccEEEEEEccccccccccHHHHHHTccccEEEEEEccccccHHHHTHHHHTTTcccEEETTEEEEEccccTTcHHHHHHHHHHHHcc########################################ccccccccccccHHHHHHHHHHHcccEEEEEcTTcccccHHHHHHHHHHTcEcccccTTcHHHHHHHHHHHHHHHHHHc#### DISOP:02AL 1-13, 260-264| PSIPRED ccccccccccccccccccccccccEEEEEEcccccHHHHHHHHHHHHHHHHHccccEEEEEEEEcccccHHHHHHHHHHHcccEEEEEEHHHHcccHHHHHHHHHHHHHHHHcccEEEEEEccccccHHHHHHHHHHHHHHHccccccccEEEEEEEccccHHHHHHHHHHHHHHHHcccccEEEEEEEEcccHHHHHHHHHHccccEEEEEEEEccccHHHHHHHHHcccEEEcccccccHHHHHHHHHHHHHHHcccccccc //