[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56265.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.17.4
:147 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   46->142 3cu3A PDBj 5e-04 25.8 %
:RPS:PDB   40->144 3cu3A PDBj 2e-06 22.9 %
:RPS:SCOP  40->144 3cu3A1  d.17.4.28 * 3e-07 24.8 %
:HMM:SCOP  12->147 1hkxA_ d.17.4.7 * 1.4e-17 27.9 %
:HMM:PFM   24->89 PF11533 * DUF3225 8.3e-05 25.8 66/126  
:BLT:SWISS 78->133 PUR4_XANAC 2e-04 48.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56265.1 GT:GENE BAD56265.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1599306..1599749 GB:FROM 1599306 GB:TO 1599749 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56265.1 LENGTH 147 SQ:AASEQ MHAEDMIIDANLPQYLPADPDAELAALREVVAAVDRAQAAEDVGAFVGQFRPDAIWTTGHGKRLFGRDAIAEFTARVLPGATAHGSATYEIERVLFLRPDVAAVKVRQRYFDADGAPASEGTPMYVLTKEDGRWLLTANQNTPVVAE GT:EXON 1|1-147:0| BL:SWS:NREP 1 BL:SWS:REP 78->133|PUR4_XANAC|2e-04|48.1|52/1348| SEG 16->37|lpadpdaelaalrevvaavdra| BL:PDB:NREP 1 BL:PDB:REP 46->142|3cu3A|5e-04|25.8|97/160| RP:PDB:NREP 1 RP:PDB:REP 40->144|3cu3A|2e-06|22.9|105/160| HM:PFM:NREP 1 HM:PFM:REP 24->89|PF11533|8.3e-05|25.8|66/126|DUF3225| RP:SCP:NREP 1 RP:SCP:REP 40->144|3cu3A1|3e-07|24.8|105/162|d.17.4.28| HM:SCP:REP 12->147|1hkxA_|1.4e-17|27.9|136/0|d.17.4.7|1/1|NTF2-like| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------11----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 108 STR:RPRED 73.5 SQ:SECSTR ######################################HTTcHHHHHTTEEEEEEEEcTTccEEEHHHHHHHHHHHHHHTTTTTcEEEEEEEEEEEEETTEEEEEEEEcTTcccccGGGccccEEEEEEETTEEEEEEEEcccccc# DISOP:02AL 1-3, 146-147| PSIPRED cccccEEEEccccccccccccHHHHHHHHHHHHHHHHHccccHHHHHHHcccccEEEccccEEEEcHHHHHHHHHHHHHHHHHccEEEcEEEEEEEccccEEEEEEEEEEEEccccccccccEEEEEEEEcccEEEEEEcccccccc //