[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56267.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:62 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   7->36 PF01597 * GCV_H 0.00033 35.7 28/122  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56267.1 GT:GENE BAD56267.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1601166..1601354 GB:FROM 1601166 GB:TO 1601354 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56267.1 LENGTH 62 SQ:AASEQ MFNALNEANKSYTQAYNDIQGHIVAANELINLTDNPLGLPDDRWPNSVATTFSNPGDWKLAE GT:EXON 1|1-62:0| HM:PFM:NREP 1 HM:PFM:REP 7->36|PF01597|0.00033|35.7|28/122|GCV_H| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 61-62| PSIPRED ccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHcccccccccccccccccccccccccccc //