[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56269.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:67 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   25->59 PF12525 * DUF3726 1e-05 37.1 35/80  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56269.1 GT:GENE BAD56269.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1602024..1602227 GB:FROM 1602024 GB:TO 1602227 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56269.1 LENGTH 67 SQ:AASEQ MAETRRAQLVPEQYEFAEMRAAEKVALAQKRAVAARTVAGHAQDAADCESLLAMLGLDAQAGKLAGQ GT:EXON 1|1-67:0| HM:PFM:NREP 1 HM:PFM:REP 25->59|PF12525|1e-05|37.1|35/80|DUF3726| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6, 65-67| PSIPRED cccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHcccccccccccc //