[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56272.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  225/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.122.1c.116.1
:246 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   20->230 1vhkC PDBj 4e-15 29.2 %
:RPS:PDB   6->230 2egvA PDBj 5e-35 23.0 %
:RPS:SCOP  6->70 1nxzA1  b.122.1.2 * 6e-12 21.5 %
:RPS:SCOP  75->230 1nxzA2  c.116.1.5 * 1e-23 23.8 %
:HMM:SCOP  2->73 1nxzA1 b.122.1.2 * 7e-14 26.4 %
:HMM:SCOP  73->246 1nxzA2 c.116.1.5 * 7.1e-46 37.3 %
:RPS:PFM   20->230 PF04452 * Methyltrans_RNA 5e-20 34.3 %
:HMM:PFM   20->240 PF04452 * Methyltrans_RNA 3.2e-58 37.5 216/225  
:BLT:SWISS 1->227 RSME_MYCTU 1e-37 52.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56272.1 GT:GENE BAD56272.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1604734..1605474 GB:FROM 1604734 GB:TO 1605474 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56272.1 LENGTH 246 SQ:AASEQ MAATVFYLDDIPEPGRVAVLDGPEGRHAATVRRTRVGEPITLSDGRGLLAASEVVAAQRDRLELRVLERTVAPRPAPEVTVVQALPKSDRSELAVDLMTEAGADAIVPWQAARCVANWEGKAAKGVEKWRSAARSAARQSRRAYIPEVADLHRTRDVLELVRGARAEGAVVAALHESGTAKFTELSFAGASRVVLIVGPEGGLDDGELVALAAAGAQVTLLGPTVLRTSTAAAVALGALGALTSRW GT:EXON 1|1-246:0| BL:SWS:NREP 1 BL:SWS:REP 1->227|RSME_MYCTU|1e-37|52.0|227/262| SEG 130->143|rsaarsaarqsrra| SEG 161->173|vrgaraegavvaa| SEG 231->242|aaavalgalgal| BL:PDB:NREP 1 BL:PDB:REP 20->230|1vhkC|4e-15|29.2|202/240| RP:PDB:NREP 1 RP:PDB:REP 6->230|2egvA|5e-35|23.0|213/229| RP:PFM:NREP 1 RP:PFM:REP 20->230|PF04452|5e-20|34.3|207/225|Methyltrans_RNA| HM:PFM:NREP 1 HM:PFM:REP 20->240|PF04452|3.2e-58|37.5|216/225|Methyltrans_RNA| GO:PFM:NREP 2 GO:PFM GO:0006364|"GO:rRNA processing"|PF04452|IPR006700| GO:PFM GO:0008168|"GO:methyltransferase activity"|PF04452|IPR006700| RP:SCP:NREP 2 RP:SCP:REP 6->70|1nxzA1|6e-12|21.5|65/72|b.122.1.2| RP:SCP:REP 75->230|1nxzA2|1e-23|23.8|151/174|c.116.1.5| HM:SCP:REP 2->73|1nxzA1|7e-14|26.4|72/72|b.122.1.2|1/1|PUA domain-like| HM:SCP:REP 73->246|1nxzA2|7.1e-46|37.3|169/174|c.116.1.5|1/1|alpha/beta knot| OP:NHOMO 225 OP:NHOMOORG 225 OP:PATTERN -------------------------------------------------------------------- -11-111111111111111-111111111111111111111111--111111111111--111111111111111111-1---------------------------------------------11111-11111--------1-----------------------------------------------11--------1------111111---1---111------11-11111111111111----1-------1----------1--1--------------------------------------1-----------11-------------------1-----1-----11--1-11-------------------------------------------------------------------------------------------------------------------------------------------1--1-1-111111--11111111--1----1----------------11----1111111---111-11---1---------1--1-11-------1--------------------------------1------------11111-111---1---1---------11-1-------------------------------------11----------------------------111111111111---11-1111111-111----11-11111-111--------------1-----------------------1--------------1-1-1--111-----1-------------------------------------------------------1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 223 STR:RPRED 90.7 SQ:SECSTR #####EEcccEE##TTEEEEETHHHHHHHHHTTccTTccEEEEETTEEEEEEEEEEEcccEEEEEEEEEccccccccEEEEEEEccccTHHHHHHHHHHHHTccEEEEEEcTTccccHHHHHHHHHHHHHHHHHHHHHHHTcccccEEcccEEGGGccccccEEEEEcTcEEETcccccGGHHHGccTTccEEEEEEccTTcccHHHHHHHHHTTcEEEccccccccHHH################ DISOP:02AL 246-247| PSIPRED ccccEEEcccccccccEEEEcHHHHHHHHHHcccccccEEEEEEccccEEEEEEEEEcccEEEEEEEEccccccccccEEEEEEEcccccHHHHHHHHHHccccEEEEEEEEEEEEcccccHHHHHHHHHHHHHHHHHHcccccccEEcccccHHHHHHHccccccccEEEEEEccccccccHHHcccccccEEEEEcccccccHHHHHHHHHcccEEEEcccccHHHHHHHHHHHHHHHHHHccc //