[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56273.1
DDBJ      :             putative transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  27/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:162 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->134 1jgsA PDBj 3e-07 25.8 %
:RPS:PDB   9->144 2a61A PDBj 3e-15 20.6 %
:RPS:SCOP  10->135 2fbiA1  a.4.5.28 * 1e-16 19.8 %
:HMM:SCOP  4->139 1jgsA_ a.4.5.28 * 7.8e-27 30.9 %
:HMM:PFM   34->92 PF01047 * MarR 1.9e-15 35.6 59/59  
:HMM:PFM   79->141 PF03284 * PHZA_PHZB 0.00029 20.6 63/162  
:BLT:SWISS 24->148 YCGE_BACSU 7e-19 33.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56273.1 GT:GENE BAD56273.1 GT:PRODUCT putative transcriptional regulator GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1605551..1606039) GB:FROM 1605551 GB:TO 1606039 GB:DIRECTION - GB:PRODUCT putative transcriptional regulator GB:PROTEIN_ID BAD56273.1 LENGTH 162 SQ:AASEQ MSKDDLIAEIGRQLRLLQRSFDTFDEAAAARLRLNRTDLRCLDVVSGSDSSTPGELARELKLSPAATTTVIDRLVRAGLVTRAPDPANRRRVLVVPTDAARAAATEIFEPVAVAGAEALARYDTDQLAVVLDFLHTALDVHHDQTMRLVARQAPPGADDARQ GT:EXON 1|1-162:0| BL:SWS:NREP 1 BL:SWS:REP 24->148|YCGE_BACSU|7e-19|33.6|125/154| BL:PDB:NREP 1 BL:PDB:REP 7->134|1jgsA|3e-07|25.8|128/138| RP:PDB:NREP 1 RP:PDB:REP 9->144|2a61A|3e-15|20.6|136/142| HM:PFM:NREP 2 HM:PFM:REP 34->92|PF01047|1.9e-15|35.6|59/59|MarR| HM:PFM:REP 79->141|PF03284|0.00029|20.6|63/162|PHZA_PHZB| RP:SCP:NREP 1 RP:SCP:REP 10->135|2fbiA1|1e-16|19.8|126/136|a.4.5.28| HM:SCP:REP 4->139|1jgsA_|7.8e-27|30.9|136/0|a.4.5.28|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 32 OP:NHOMOORG 27 OP:PATTERN -------------------------------------------------------------------- ----3---111-------------------------11------111-1---211-----221-----11------------1--------------------------------------------------------------------------------------------------------------1-----------------1111-----------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 150 STR:RPRED 92.6 SQ:SECSTR #cHHcHHHHHHHHHHHHHHHHHHHHHTTHHHHTccHHHHHHHHHHHHHccccHHHHHHHHTccHHHHHHHHHHHHHTTcEEEEEETTEEEEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHEEEEEEE########### DISOP:02AL 143-162| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHccccccHHHHHHHHcccHHHHHHHHHHHHHcccEEcccccccccEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccc //