[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56280.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.97.1
:119 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  3->74 1wn5A1 c.97.1.1 * 1.7e-05 36.1 %
:HMM:PFM   25->66 PF08211 * dCMP_cyt_deam_2 0.00027 38.1 42/124  
:HMM:PFM   95->112 PF08152 * GUCT 0.00063 38.9 18/97  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56280.1 GT:GENE BAD56280.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1612114..1612473 GB:FROM 1612114 GB:TO 1612473 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56280.1 LENGTH 119 SQ:AASEQ MTELDAEDTKLVVLARGALGRTGGTAGAAVRDTDGRTYAAGEVDLAALRLTALQAAVAAAISSGAEGFEAAVVVGGKFSDPGVTAVREVSGAARIIFTDKAGAVFDIVDDAAGAEVQGG GT:EXON 1|1-119:0| SEG 13->35|vlargalgrtggtagaavrdtdg| SEG 45->60|laalrltalqaavaaa| HM:PFM:NREP 2 HM:PFM:REP 25->66|PF08211|0.00027|38.1|42/124|dCMP_cyt_deam_2| HM:PFM:REP 95->112|PF08152|0.00063|38.9|18/97|GUCT| HM:SCP:REP 3->74|1wn5A1|1.7e-05|36.1|72/0|c.97.1.1|1/1|Cytidine deaminase-like| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 117-119| PSIPRED cccccccccEEEEEEEccccccccccccEEEEccccEEEEEEEEHHHHHHHHHHHHHHHHHHHccccEEEEEEEEcccccccHHHHHHccccEEEEEEcccccEEEEEccccccEEccc //