[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56289.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  13/915 : Eukaryota  32/199 : Viruses  0/175   --->[See Alignment]
c.66.1
:377 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  263->338 1zx0A1 c.66.1.16 * 0.00024 26.3 %
:RPS:PFM   19->329 PF11899 * DUF3419 1e-31 32.7 %
:HMM:PFM   16->369 PF11899 * DUF3419 1.3e-82 31.9 351/380  
:BLT:SWISS 257->324 PANB_COXBU 4e-04 29.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56289.1 GT:GENE BAD56289.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1627274..1628407 GB:FROM 1627274 GB:TO 1628407 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56289.1 LENGTH 377 SQ:AASEQ MTAAPATTATPTAVTDRWLLYSTCDEDSRSELRALTIGEGDDVLAVTGSGCRALSLVVHNPRSVTSVDSSAGQTYLLELKLAAIRHFSYDTLLEFLGVDPSRDRWRLFEELTPALSPGAVAYFTRYHKAIRGGVLLAGRHERLYVRLVAPMMRTLYGSAMKELFAAADLEAQRRVYREKIDGVLWRTLIRRGFTERTLKTVLNDDSYNVVTDVQSCGDYVLERLEHTLTEHLVRDNDWVSFMLHGRYPDRNVLPHYLLRDSVEAIRSAETKVEPVRADLMAHLRALPDGSIDKFSLSDVTSCIDRAQFATMMTEVVRVARPGARICYRNFLSRHRPDPSFAAVLRRDDALCEQLYHDDYAFVYQFEIFTVGEPGAVA GT:EXON 1|1-377:0| BL:SWS:NREP 1 BL:SWS:REP 257->324|PANB_COXBU|4e-04|29.4|68/266| SEG 2->13|taapattatpta| SEG 221->232|lerlehtltehl| RP:PFM:NREP 1 RP:PFM:REP 19->329|PF11899|1e-31|32.7|309/368|DUF3419| HM:PFM:NREP 1 HM:PFM:REP 16->369|PF11899|1.3e-82|31.9|351/380|DUF3419| HM:SCP:REP 263->338|1zx0A1|0.00024|26.3|76/0|c.66.1.16|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 45 OP:NHOMOORG 45 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------1--11-111--111-----------------------------------------------------------------------------1-----------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---------------11----------------11-----------1-111111111--1-1-----------11-----------------1--111111------1--------------------------------------------------------------------11--1---11-----1------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6, 376-377| PSIPRED ccccccccccccccccccEEccccccccHHHHHHHccccccEEEEEEccHHHHHHHHHccccEEEEEEccHHHHHHHHHHHHHHHHccHHHHHHHHcccccccHHHHHHHHcccccHHHHHHHHHHHHcccccEEEEccHHHHHHHHHHHHHHHHHHccHHHHHccccHHHHHHHHHHHccHHHHHHHHHHHHcccHHHHcccccHHHHHHccccHHHHHHHHHHHHHHHccccccHHHHHHHHccccccccccHHccHHHHHHHHcccccEEEEHHHHHHHHHHcccccccEEEEEcccccccHHHHHHHHHHHHHHcccccEEEEEccccccccccccHHHHHccHHHHHHHHHccccEEEEEEEEEEccccccc //