[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56292.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:135 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   32->120 PF03153 * TFIIA 0.00032 30.3 89/358  
:HMM:PFM   10->28 PF08085 * Entericidin 0.00075 31.6 19/42  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56292.1 GT:GENE BAD56292.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1630581..1630988 GB:FROM 1630581 GB:TO 1630988 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56292.1 LENGTH 135 SQ:AASEQ MQHNARRTVRRFAVAAMLTGLALAAAGCGDDDASTEQSTTTRSTTTRPTTTAPASATTSITPPTTTVEPPAPAPEPAAPAPAPQQAPAPQQAPAPQQAPAPQPAPQQAPTQQQAPAPQPEPPTLPDPGFEPRPGY GT:EXON 1|1-135:0| SEG 5->123|arrtvrrfavaamltglalaaagcgdddasteqstttrstttrptttapasattsitpptttveppapapepaapapapqqapapqqapapqqapapqpapqqaptqqqapapqpeppt| HM:PFM:NREP 2 HM:PFM:REP 32->120|PF03153|0.00032|30.3|89/358|TFIIA| HM:PFM:REP 10->28|PF08085|0.00075|31.6|19/42|Entericidin| OP:NHOMO OP:NHOMOORG 0 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-135| PSIPRED ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc //