[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56299.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  26/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:137 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   97->128 PF04290 * DctQ 0.00079 40.6 32/133  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56299.1 GT:GENE BAD56299.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1636512..1636925 GB:FROM 1636512 GB:TO 1636925 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56299.1 LENGTH 137 SQ:AASEQ MDAAVTPDQELQARAGACLTRYDVDVRVDPEGSLGFEYEGALCSLRAVNLAPGLDVLSLTCVLAWDRPLKPQLHKRVAERNNALQFGSLTVIAHGKLADVILRYTFPAAGLDDQALTTMLLLVLSGAGRARQGLLAP GT:EXON 1|1-137:0| HM:PFM:NREP 1 HM:PFM:REP 97->128|PF04290|0.00079|40.6|32/133|DctQ| OP:NHOMO 26 OP:NHOMOORG 26 OP:PATTERN -------------------------------------------------------------------- --------------11111-11--1111111111111111------------------------111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4| PSIPRED ccccccccHHHHHHHHHHHHHHHcccEEcccccEEEEEcccEEEEEEEEEcccccHHHHHHHHHccccccHHHHHHHHHHHccccccEEEEEEcccEEEEEEEEEcccccccHHHHHHHHHHHHcccHHHHHHcccc //