[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56300.1
DDBJ      :             putative transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  80/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
a.121.1a.4.1
:205 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->57 1rktA PDBj 1e-10 49.1 %
:RPS:PDB   10->176 3bniA PDBj 1e-17 14.4 %
:RPS:SCOP  12->71 1z77A1  a.4.1.9 * 1e-15 26.7 %
:RPS:SCOP  84->188 2id3A2  a.121.1.1 * 1e-04 25.7 %
:HMM:SCOP  1->81 1rktA1 a.4.1.9 * 1.3e-17 35.8 %
:HMM:SCOP  84->199 2gfnA2 a.121.1.1 * 2.6e-11 25.0 %
:RPS:PFM   16->62 PF00440 * TetR_N 3e-07 48.9 %
:HMM:PFM   16->62 PF00440 * TetR_N 9.7e-19 48.9 47/47  
:BLT:SWISS 2->58 YFIR_BACSU 3e-12 49.1 %
:PROS 28->59|PS01081|HTH_TETR_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56300.1 GT:GENE BAD56300.1 GT:PRODUCT putative transcriptional regulator GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1636911..1637528) GB:FROM 1636911 GB:TO 1637528 GB:DIRECTION - GB:PRODUCT putative transcriptional regulator GB:PROTEIN_ID BAD56300.1 LENGTH 205 SQ:AASEQ MPRVSEEHLERRRQQILDAAQLCFARKGFHETSMQDVFAESGLSAGAVYRYFKSKNDLVAALAGQTSVQLRSVIAATVRADPLPPPAELVHTIALEVMRRTGPDGLARLAPQAWALALVNEDAAVAVRAAMGGIRELWFEYAERMHRAGWLAPGTDLDAVAKTLFAMLPGFVLEHLILGDVDAGTLARGVEALMPMAAPLPSGRE GT:EXON 1|1-205:0| BL:SWS:NREP 1 BL:SWS:REP 2->58|YFIR_BACSU|3e-12|49.1|57/205| PROS 28->59|PS01081|HTH_TETR_1|PDOC00830| BL:PDB:NREP 1 BL:PDB:REP 2->57|1rktA|1e-10|49.1|55/201| RP:PDB:NREP 1 RP:PDB:REP 10->176|3bniA|1e-17|14.4|167/174| RP:PFM:NREP 1 RP:PFM:REP 16->62|PF00440|3e-07|48.9|47/47|TetR_N| HM:PFM:NREP 1 HM:PFM:REP 16->62|PF00440|9.7e-19|48.9|47/47|TetR_N| GO:PFM:NREP 2 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00440|IPR001647| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00440|IPR001647| RP:SCP:NREP 2 RP:SCP:REP 12->71|1z77A1|1e-15|26.7|60/75|a.4.1.9| RP:SCP:REP 84->188|2id3A2|1e-04|25.7|105/123|a.121.1.1| HM:SCP:REP 1->81|1rktA1|1.3e-17|35.8|81/0|a.4.1.9|1/1|Homeodomain-like| HM:SCP:REP 84->199|2gfnA2|2.6e-11|25.0|116/0|a.121.1.1|1/1|Tetracyclin repressor-like, C-terminal domain| OP:NHOMO 108 OP:NHOMOORG 81 OP:PATTERN -------------------------------------------------------------------- --1-2-1-----1-32122-21--1122222111113222---1-2-1-------112--22--212--11-------------------------------------------------------------------------2---------------------1----------------1------------------------------1-------1---------1----------------------------------------------------------------------------------------------------------------------1------------------------1-1-------1112--------------------11111211-1---------------1------------------------------------------------------------------------1---------------------1--------1-----11--11------2-----------11------------------------------------------------------------------1------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------1-1---------------------------------11---------------1------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 205 STR:RPRED 100.0 SQ:SECSTR ccccccccHHHHHHHHHHHHHHHHHHHcTTTccHHHHHHHHTccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcTTTTTcccccHHHHHHHHHHHHHTccccHHHHHHHHHHHHHHHHHHHHHHHHcTTccHHHHHHHHHHHHHHHHHTcHHHHHHHHHHHHHHHHHHHTGGGGT DISOP:02AL 1-15, 201-205| PSIPRED ccccccccHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHcccccHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccccccc //