[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56301.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  14/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:325 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 168->261 PTXBC_BACSU 1e-05 36.6 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56301.1 GT:GENE BAD56301.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1637630..1638607 GB:FROM 1637630 GB:TO 1638607 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56301.1 LENGTH 325 SQ:AASEQ MNTLRRALAVGLGAALLQALMLIAFAWPAANLAPRDLPIAVAGPQAAAVAERLTAHSPGAFAVTTLPDGAAARAAIADREVYGAIVTGEGAPRTLVASAASPAVAQQLTAMAQQLSGAQGGAVEDVVAADPDDPRGAAFGAMVLPLVMSGIAAGVLLSLLVTGSSARLAGVVTFGVAGGLLSMALAQGWLSALPGSYPALAAVAGLASFGVAGAIVGLNAVIGRAGIGLGALTMLLIGNPFSAATSAPELLPQPWGALGQLLPPGAASALLRSVAFFDGAGATKPLVVLLVWAACGIALLGVAALRERAGGAEREVTTPSEPALA GT:EXON 1|1-325:0| BL:SWS:NREP 1 BL:SWS:REP 168->261|PTXBC_BACSU|1e-05|36.6|93/455| TM:NTM 7 TM:REGION 9->31| TM:REGION 139->161| TM:REGION 168->190| TM:REGION 196->218| TM:REGION 222->244| TM:REGION 250->272| TM:REGION 285->306| SEG 4->26|lrralavglgaallqalmliafa| SEG 40->50|avagpqaaava| SEG 70->77|aaaraaia| SEG 95->108|lvasaaspavaqql| SEG 117->141|gaqggavedvvaadpddprgaafga| SEG 152->166|aagvllsllvtgssa| SEG 298->316|allgvaalreraggaerev| OP:NHOMO 20 OP:NHOMOORG 14 OP:PATTERN -------------------------------------------------------------------- ----1------11-----------------------1222--1--1---------1-1----------23-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 311-317, 320-325| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccEEEcHHHHHHHHHHHHccccccEEEEcccHHHHHHHHHcccEEEEEEEcccccEEEEEEccHHHHHHHHHHHHHHHHHcccccEEEcccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHccHHHccccHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccc //