[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56302.1
DDBJ      :             putative ferric uptake regulator
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  704/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:141 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   13->136 2o03A PDBj 8e-53 71.8 %
:RPS:PDB   15->96 1bibA PDBj 3e-05 17.3 %
:RPS:SCOP  13->134 1mzbA  a.4.5.42 * 5e-24 32.0 %
:HMM:SCOP  3->135 1mzbA_ a.4.5.42 * 8.7e-37 39.8 %
:RPS:PFM   13->129 PF01475 * FUR 4e-23 41.9 %
:HMM:PFM   13->129 PF01475 * FUR 1.3e-37 39.3 117/120  
:BLT:SWISS 1->138 FUR_SHIFL 8e-21 38.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56302.1 GT:GENE BAD56302.1 GT:PRODUCT putative ferric uptake regulator GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1638753..1639178) GB:FROM 1638753 GB:TO 1639178 GB:DIRECTION - GB:PRODUCT putative ferric uptake regulator GB:PROTEIN_ID BAD56302.1 LENGTH 141 SQ:AASEQ MQDKTSAPQKPVGIRSTRQRSAIAALLGDIDEFRSAQELHDELRKRGEGIGLTTVYRTLQSLADAGMVDVLRTDSGESVYRQCSSGHHHHLVCRHCGRTVEVAGPTVEAWADAIAGEHGFTDVSHTIEVFGTCRDCAERRS GT:EXON 1|1-141:0| BL:SWS:NREP 1 BL:SWS:REP 1->138|FUR_SHIFL|8e-21|38.0|137/148| BL:PDB:NREP 1 BL:PDB:REP 13->136|2o03A|8e-53|71.8|124/129| RP:PDB:NREP 1 RP:PDB:REP 15->96|1bibA|3e-05|17.3|75/294| RP:PFM:NREP 1 RP:PFM:REP 13->129|PF01475|4e-23|41.9|117/120|FUR| HM:PFM:NREP 1 HM:PFM:REP 13->129|PF01475|1.3e-37|39.3|117/120|FUR| GO:PFM:NREP 2 GO:PFM GO:0003700|"GO:transcription factor activity"|PF01475|IPR002481| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF01475|IPR002481| RP:SCP:NREP 1 RP:SCP:REP 13->134|1mzbA|5e-24|32.0|122/133|a.4.5.42| HM:SCP:REP 3->135|1mzbA_|8.7e-37|39.8|133/134|a.4.5.42|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 1057 OP:NHOMOORG 708 OP:PATTERN --------------------------------------------------21---------------- -11-211111111111211-11111111111111111111232321111111111121--34212212231111121111-1322222-------------------------------------11-223112242113244412822411222443-132121223322222122221121-2121---223333333333333333325523333333323322222235333333333333333222333---11-1---22--11111--------------11-------------------------11111111-22122111111121221333222121223-13-33522113332211---211111111111--1112111111111111111111---------3-2-2222222222221111111-11111111111111111112321-----------------------------111111122111111112111111221111111112222-1222211114111121111-1111111111111111113111--42242221323224212222212122121111111111111111111-1111113111111111122112111111111111---1221------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111--111111111-1111111111111111111111111111111111111111111111111111111111111111222222221211111111111111111-11-1---------------------------------------2---121111-- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 133 STR:RPRED 94.3 SQ:SECSTR ########cTTccHcccHHHHHHHHHHTTTcccccHHHHHHHHHHTTcTccHHHHHHHHHHHHHTTccccEEETTTEEEcccccccccHHHHHHTcHHEEEEEEETTEEEEEEcHHHHHHHHHHHTcTEEEEETTTHHHHT DISOP:02AL 138-141| PSIPRED ccHHHHHHHHHccccccHHHHHHHHHHHHccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHcccEEEEEEcccEEEEEEcccccccEEEEcccccEEEcccccHHHHHHHHHHHHccEEEEEEEEEEEEcHHHHcccc //