[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56308.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:118 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   40->82 PF11292 * DUF3093 0.00025 32.6 43/143  
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56308.1 GT:GENE BAD56308.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1643928..1644284 GB:FROM 1643928 GB:TO 1644284 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56308.1 LENGTH 118 SQ:AASEQ MNMNSKTPPPLVGSLLTVIGAGHTGLGVVDWLTKDQPTELSFWFTGFGVAGMALGVAVMEVERARGYVPGPVLAAVAAMTAFGLAFEPMSGFLTVLVPLGIGVAGWAKRRSVRTVHRG GT:EXON 1|1-118:0| TM:NTM 3 TM:REGION 10->32| TM:REGION 40->62| TM:REGION 76->98| HM:PFM:NREP 1 HM:PFM:REP 40->82|PF11292|0.00025|32.6|43/143|DUF3093| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-10, 114-118| PSIPRED cccccccccHHHHHHHHHHcccccccHHHHHHcccccccEEEEEHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHcccHHHHHHHHHHHHcccc //