[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56310.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  15/68 : Bacteria  509/915 : Eukaryota  28/199 : Viruses  0/175   --->[See Alignment]
d.157.1
:225 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   27->213 2zwrB PDBj 2e-17 37.9 %
:RPS:PDB   34->212 2bfkA PDBj 1e-17 20.8 %
:RPS:SCOP  34->224 1qh3A  d.157.1.2 * 3e-21 22.3 %
:HMM:SCOP  26->221 1qh5A_ d.157.1.2 * 3.9e-43 40.4 %
:RPS:PFM   36->171 PF00753 * Lactamase_B 6e-09 39.2 %
:HMM:PFM   34->204 PF00753 * Lactamase_B 9.2e-25 29.3 157/194  
:BLT:SWISS 33->216 YCBL_ECOLI 3e-18 32.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56310.1 GT:GENE BAD56310.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1646321..1646998 GB:FROM 1646321 GB:TO 1646998 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56310.1 LENGTH 225 SQ:AASEQ MITIDRPYTGHVSPGSNPQQRDLDGARIVKMAVGGMDNNVYLVQCAATGAAVLIDAANEADRILELVEQEMPGKVRLIVTTHQHPDHWAALQQVAAALDVPTAAHALDAEPLPVKPYRLLDDGETVEIGELALDVIHLRGHTPGSLALALPEPAVRTHLFTGDSLFPGGVGKTWSPADFDTLLGDVTTKIFDRYDDDTVVYPGHGDDTTLGVERPHLNEWRERGW GT:EXON 1|1-225:0| BL:SWS:NREP 1 BL:SWS:REP 33->216|YCBL_ECOLI|3e-18|32.4|179/215| SEG 89->100|aalqqvaaaldv| BL:PDB:NREP 1 BL:PDB:REP 27->213|2zwrB|2e-17|37.9|174/207| RP:PDB:NREP 1 RP:PDB:REP 34->212|2bfkA|1e-17|20.8|173/220| RP:PFM:NREP 1 RP:PFM:REP 36->171|PF00753|6e-09|39.2|130/171|Lactamase_B| HM:PFM:NREP 1 HM:PFM:REP 34->204|PF00753|9.2e-25|29.3|157/194|Lactamase_B| GO:PFM:NREP 1 GO:PFM GO:0016787|"GO:hydrolase activity"|PF00753|IPR001279| RP:SCP:NREP 1 RP:SCP:REP 34->224|1qh3A|3e-21|22.3|184/260|d.157.1.2| HM:SCP:REP 26->221|1qh5A_|3.9e-43|40.4|188/260|d.157.1.2|1/1|Metallo-hydrolase/oxidoreductase| OP:NHOMO 724 OP:NHOMOORG 552 OP:PATTERN ------11-------1---------421-111-----------------111------------1-11 -111421333232333244-4311234444424333234512223-22-11-222221--22213273334-------1113211111111111111--1----132111--------------11-11-1----1111221111111-111-----------1-1---1-------------11-11---21-11111111111111111111-111111-111---1-1211222122122222221--11----------------------------------------------------------------------12111-------1-111221111111--12111111111121111111--11-1111-------12111111111------------11111111--1-------------1111-----------------------1112------------------------------1111------1111111111111111111111112222-1111111111-111-1-241-1111111111---211-31211-111---1-11111111211112312-1-1--1-111-----------1----1-11111---111111-11111111111-1---1112------11111111111111111-11111111111111111111111111-1111111111111111111111111-11111111111111-----------211--111111111111111111111111---1111111-111111-------------11111111111111----------------1111--------------1-----------------------------------11- -----------1--1-1--1--1---1111-----1-------11--111--1---1-1---------------------------11----1----------1-----2------------------------------------------------------1-------------1D-----1---1--------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 225 STR:RPRED 100.0 SQ:SECSTR TcTTcccccEEEEEEEEEEEEEEccEEEEEETTcEEEEEEEEEEETccTEEEEEccHHHHHHHHHHHHHHHTccEEEEEcccccHHHHTTHHHHHHTTccEEEccHHHHHHHHHTcccccccEEEEEETTEEEEEEccccccccccEEEETTTTETTEEEEETTcccTTcccccccccccHHHHHHHHHHHHHcccccEEEEcccccccTHHHHHHHHHHHHHcE PSIPRED cccccccccccccccccccEEEccccEEEEEEccccccEEEEEEEccccEEEEEcccccHHHHHHHHHHHccccEEEEEEcccccccccHHHHHHHHHcccEEEcHHHHccccccccEEEccccEEEEccEEEEEEEEcccccccEEEEEccccccEEEEEccEEEccccccccccccHHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHccc //