[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56311.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  15/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.71.1
:190 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   103->187 2b3zD PDBj 2e-11 17.9 %
:RPS:SCOP  32->188 1cz3A  c.71.1.1 * 4e-11 21.3 %
:HMM:SCOP  3->187 2b3zA1 c.71.1.2 * 2.9e-19 26.8 %
:RPS:PFM   104->175 PF01872 * RibD_C 4e-06 38.6 %
:HMM:PFM   7->180 PF01872 * RibD_C 2.3e-19 21.2 160/200  
:BLT:SWISS 109->184 YYAP_BACSU 3e-04 25.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56311.1 GT:GENE BAD56311.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1647138..1647710) GB:FROM 1647138 GB:TO 1647710 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56311.1 LENGTH 190 SQ:AASEQ MTAVYTFDVFTSLDGFGSYGPDGDWGGYWGKHGPEFLDHRLAQMTEDQRMVLGANTFREFVEMIGAVPDLDPINARMRSMPTTVVSTTLTDTAPWPDATLAPGDAVDIVARLKAESDVPLRSHGSLSMNRALMAAGLVDRVQVTIFPVITGRTGEAPIFRGAEDFDLELLDSRTFDNRIQELIYRPTRHG GT:EXON 1|1-190:0| BL:SWS:NREP 1 BL:SWS:REP 109->184|YYAP_BACSU|3e-04|25.3|75/100| SEG 15->30|gfgsygpdgdwggywg| SEG 82->92|ttvvsttltdt| RP:PDB:NREP 1 RP:PDB:REP 103->187|2b3zD|2e-11|17.9|84/360| RP:PFM:NREP 1 RP:PFM:REP 104->175|PF01872|4e-06|38.6|70/198|RibD_C| HM:PFM:NREP 1 HM:PFM:REP 7->180|PF01872|2.3e-19|21.2|160/200|RibD_C| GO:PFM:NREP 2 GO:PFM GO:0008703|"GO:5-amino-6-(5-phosphoribosylamino)uracil reductase activity"|PF01872|IPR002734| GO:PFM GO:0009231|"GO:riboflavin biosynthetic process"|PF01872|IPR002734| RP:SCP:NREP 1 RP:SCP:REP 32->188|1cz3A|4e-11|21.3|141/164|c.71.1.1| HM:SCP:REP 3->187|2b3zA1|2.9e-19|26.8|179/0|c.71.1.2|1/1|Dihydrofolate reductase-like| OP:NHOMO 20 OP:NHOMOORG 15 OP:PATTERN -------------------------------------------------------------------- ----3--------------------1----------2121-----1------11------------1-11-------------------------------------2----------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 160 STR:RPRED 84.2 SQ:SECSTR ##############################HccHHHHHHHHHHHHHHTEEEEEHHHHHHHcGGGcccHHccccTccccTTcEEEEEcccccccccTTEEEEcccHHHHHHHHHHTTccEEEEEEcHHHHHHHHHHTcccEEEEEEEccccccTTcccccccGGcccEEEEEEEEETTEEEcEEEEEcEcc DISOP:02AL 188-190| PSIPRED ccEEEEEEEEEEEEEEEEccccccccccccccccHHHHHHHHHHHcccEEEEccHHHHHHHHHccccccccccHHHHccccEEEEEcccccccccccEEEEcccHHHHHHHHHHccccEEEEEccHHHHHHHHHcccccEEEEEEEEEEEccccccccccccccccEEEEEEEEccccEEEEEEEEEEcc //