[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56316.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  27/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:84 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   5->35 PF05433 * Rick_17kDa_Anti 3.1e-05 45.2 31/44  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56316.1 GT:GENE BAD56316.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1653121..1653375) GB:FROM 1653121 GB:TO 1653375 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56316.1 LENGTH 84 SQ:AASEQ MLRLLIGVAAGYVLGSKAGRARYEQISAATRAVTGSPVTRKLVLVGRQKLSDKLSTRPQLEPMVPLDERTTVLVPHDQLRHKSK GT:EXON 1|1-84:0| HM:PFM:NREP 1 HM:PFM:REP 5->35|PF05433|3.1e-05|45.2|31/44|Rick_17kDa_Anti| OP:NHOMO 27 OP:NHOMOORG 27 OP:PATTERN -------------------------------------------------------------------- ------111111--1--11-1111-111111-11111111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 77-84| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHccccccHHHHEEcccccEEEcccHHHccccc //