[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56318.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5a.6.1
:77 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   19->69 1biaA PDBj 4e-04 21.6 %
:RPS:SCOP  15->61 1j5yA1  a.4.5.1 * 3e-04 27.7 %
:HMM:SCOP  18->71 1j9iA_ a.6.1.5 * 0.00027 28.3 %
:HMM:PFM   16->38 PF08279 * HTH_11 3e-06 45.5 22/55  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56318.1 GT:GENE BAD56318.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1654017..1654250 GB:FROM 1654017 GB:TO 1654250 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56318.1 LENGTH 77 SQ:AASEQ MRTCQVEGKTWCMPNSEHPLSAAEVAERLNLSRRAVVDLIRRGELAAQKLPGRTGAYVISPKAVQDYIATRTEAASA GT:EXON 1|1-77:0| RP:PDB:NREP 1 RP:PDB:REP 19->69|1biaA|4e-04|21.6|51/292| HM:PFM:NREP 1 HM:PFM:REP 16->38|PF08279|3e-06|45.5|22/55|HTH_11| RP:SCP:NREP 1 RP:SCP:REP 15->61|1j5yA1|3e-04|27.7|47/65|a.4.5.1| HM:SCP:REP 18->71|1j9iA_|0.00027|28.3|53/68|a.6.1.5|1/1|Putative DNA-binding domain| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 51 STR:RPRED 66.2 SQ:SECSTR ##################cccHHHHHHHHTccHHHHHHHHHHHHHTTcccEEETTTEEEcccccccccH######## DISOP:02AL 1-5, 74-77| PSIPRED cccccccccEEccccccccccHHHHHHHHccHHHHHHHHHHcccHHHHHcccccccEEEcHHHHHHHHHHHHHcccc //