[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56321.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:41 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   8->38 PF07884 * VKOR 0.00071 19.4 31/138  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56321.1 GT:GENE BAD56321.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1655142..1655267 GB:FROM 1655142 GB:TO 1655267 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56321.1 LENGTH 41 SQ:AASEQ MTGRHRAPVTPIDWAYYRAYLVVIASVVSPLVVAWLIYFTP GT:EXON 1|1-41:0| TM:NTM 1 TM:REGION 17->39| SEG 21->34|lvviasvvsplvva| HM:PFM:NREP 1 HM:PFM:REP 8->38|PF07884|0.00071|19.4|31/138|VKOR| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6| PSIPRED ccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //