[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56323.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  66/915 : Eukaryota  14/199 : Viruses  0/175   --->[See Alignment]
c.116.1
:165 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   65->139 2ha8B PDBj 4e-07 36.0 %
:RPS:PDB   5->145 3e5yA PDBj 3e-15 17.9 %
:RPS:SCOP  5->141 1ipaA1  c.116.1.1 * 2e-18 23.5 %
:HMM:SCOP  5->143 1v2xA_ c.116.1.1 * 1.4e-22 26.8 %
:RPS:PFM   11->140 PF00588 * SpoU_methylase 4e-06 30.4 %
:HMM:PFM   7->140 PF00588 * SpoU_methylase 1.8e-22 24.2 132/142  
:BLT:SWISS 65->139 TARB1_HUMAN 1e-06 36.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56323.1 GT:GENE BAD56323.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1656103..1656600 GB:FROM 1656103 GB:TO 1656600 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56323.1 LENGTH 165 SQ:AASEQ MTGFFGVAVWHPKHEVNVGTLWRSALTYEAAMLATVGRRYKPQAGDTTKAPNSIPLHHFEDVADLVDHLPHGCPLIGVELDPRAESLTTFAHPRRALYLLGAEDHGLPEAVLTLCHQVIQIPSPAPWSLNVSVAGSLVLHDRFVKESQRKALANPAARLAQAVTA GT:EXON 1|1-165:0| BL:SWS:NREP 1 BL:SWS:REP 65->139|TARB1_HUMAN|1e-06|36.0|75/1621| SEG 151->162|alanpaarlaqa| BL:PDB:NREP 1 BL:PDB:REP 65->139|2ha8B|4e-07|36.0|75/154| RP:PDB:NREP 1 RP:PDB:REP 5->145|3e5yA|3e-15|17.9|140/156| RP:PFM:NREP 1 RP:PFM:REP 11->140|PF00588|4e-06|30.4|125/143|SpoU_methylase| HM:PFM:NREP 1 HM:PFM:REP 7->140|PF00588|1.8e-22|24.2|132/142|SpoU_methylase| GO:PFM:NREP 3 GO:PFM GO:0003723|"GO:RNA binding"|PF00588|IPR001537| GO:PFM GO:0006396|"GO:RNA processing"|PF00588|IPR001537| GO:PFM GO:0008173|"GO:RNA methyltransferase activity"|PF00588|IPR001537| RP:SCP:NREP 1 RP:SCP:REP 5->141|1ipaA1|2e-18|23.5|136/158|c.116.1.1| HM:SCP:REP 5->143|1v2xA_|1.4e-22|26.8|138/191|c.116.1.1|1/1|alpha/beta knot| OP:NHOMO 88 OP:NHOMOORG 80 OP:PATTERN -------------------------------------------------------------------- ------------------------------------2-------------------1-------------1------------------------------1-1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111----------------------1-11---------------------------------------------------------------------------1-----------------------------1--1-1------------------------1-----------------------------11-1-11-111-11111111111111111------------------------------------------------------------------------------------------------------------------1-------------------------------1111-1111-111----------2221111111-211------------------------------------------------------------------------- --11--------------------------------------------------------------------------------------------------------2--------------------------------------------------------------------121211-----1-11-1----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 142 STR:RPRED 86.1 SQ:SECSTR ###ccEEEEEccccHHHHHHHHHHHHHHTcEEEEEccccccccHHHHHHTHHHHTcEEEccHHHHHHHHccGGGEEEEccTTccEEGGGccccTTcEEEEEcTTTcccHHHHTcGGGEEEccccccccccHHHHHHHHHHHHHHH#################### DISOP:02AL 145-158| PSIPRED ccccEEEEEEccccccHHHHHHHHHHHccccEEEEcccccccccHHHHHHHHcccEEEEccHHHHHHHHHcccEEEEEEccccccccHHccccccEEEEEEcccccccHHHHHHcccEEEcccccccHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHcc //