Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56326.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:91 amino acids
:HMM:PFM   42->83 PF03457 * HA 4e-05 23.8 42/68  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56326.1 GT:GENE BAD56326.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1657023..1657298 GB:FROM 1657023 GB:TO 1657298 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56326.1 LENGTH 91 SQ:AASEQ MQRGWSIHQSDMATVFGYEGHQLVVRWSDHGVATAGELRRGGTVVTRRGWFPDREVGAWVREQLADLPRQELARVRRSLLDSVAEATEVQP GT:EXON 1|1-91:0| SEG 39->49|rrggtvvtrrg| HM:PFM:NREP 1 HM:PFM:REP 42->83|PF03457|4e-05|23.8|42/68|HA| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7, 90-91| PSIPRED cccccccccccHHHEEcccccEEEEEEcccccccccHHccccEEEEEccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccc //