[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56327.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:80 amino acids
:PSIPRED
:DISOPRED
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56327.1 GT:GENE BAD56327.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1657295..1657537 GB:FROM 1657295 GB:TO 1657537 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56327.1 LENGTH 80 SQ:AASEQ MSDLFTLWIPRAAVMAALGWLLWVAACIAVENLLVPSAYLACDLCDDPDCEGCDPTDGFDGEAWDRARDLEQDRQWGIAS GT:EXON 1|1-80:0| TM:NTM 1 TM:REGION 14->36| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 79-80| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHEEcccccccccccccccccccHHHHHHHHHHHHcccccc //