[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56330.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:76 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   12->64 PF08142 * AARP2CN 0.00032 22.6 53/84  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56330.1 GT:GENE BAD56330.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1658468..1658698 GB:FROM 1658468 GB:TO 1658698 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56330.1 LENGTH 76 SQ:AASEQ MTRPIPRREDLHLLLSDGWAWTEFRLDDRRLVVTGYERDQDSNVLHPMHCTTHALADIKQIHELTGAVIDALEGPQ GT:EXON 1|1-76:0| HM:PFM:NREP 1 HM:PFM:REP 12->64|PF08142|0.00032|22.6|53/84|AARP2CN| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 75-76| PSIPRED ccccccccccEEEEEEcccEEEEEEEcccEEEEEccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccc //