[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD56331.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:178 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 47->124 CBIO2_LACC3 3e-04 32.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD56331.1 GT:GENE BAD56331.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1658695..1659231 GB:FROM 1658695 GB:TO 1659231 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD56331.1 LENGTH 178 SQ:AASEQ MTEIQAWTNADLAYKIVLLKTLADLVLEEFKQAKAIMGEQIARGDSIAARTLDDRKLGKVTKSDPKPEAVVKDRDALDAWLRVEFPDKIETRVELGRLDEVLAVLIDAGRQDLIGQVEVVPDHLVGVAKAAALKGREVPGIEVVPGKPVVSARAELAAHYVVRELLSGAQVPLLGIEA GT:EXON 1|1-178:0| BL:SWS:NREP 1 BL:SWS:REP 47->124|CBIO2_LACC3|3e-04|32.1|78/278| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 60-64| PSIPRED cccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHccccHHHcccccccccccHHHcccHHHHHEEEEcccHHHHHHHHHHHHHHHHHHHHHcccHHHccHHEEcHHHHHHHHHHHHHcccccccEEEEccccHHHHHHHHHHHHHHHHHHccccccEEEccc //